New York State College of Agriculture at Cornell University 1953-54 T H E C O L L E G E O F A G R IC U L T U R E A T C O R N E L L U N IV E R S IT Y IS A C O N TR A C T U N IT O F T H E STA TE U N IV E R SIT Y OF N E W Y O R K Neal Dow Becker, Chairman Dorothy McS. Arnold Frank W. Beneway William D. P. Carey Walker L. Cisler John L. Collyer Frank S. Columbus William B. Cornell Edward R. Corsi Arthur H. Dean Thomas E. Dewey Mary H. Donlon C. Chester DuMond Victor Emanuel Horace C. Flanigan Edwin T. Gibson Larry E. Gubb Oswald D. Heck Louis Hollander Ruth F. Irish Herbert Fisk Johnson Harold Keller Albert K. Mitchell Frank C. Moore Thomas A. Murray Floyd R. Newman Nicholas H. Noyes John S. Parke Thomas W. Pew George R. Pfann Joseph P. Ripley Francis H. Scheetz Jacob G. Schurman, Jr. Harold M. Stanley Harry G. Stutz Myron C. Taylor Reese H. Taylor Walter C. Teagle Robert E. Treman Elbert P. Tuttle Maxwell M. Upson Preston A. Wade J. Carlton Ward, Jr. L. A. Wilson Deane W. Malott, A.B., M.B.A., LL.D. President of Cornell University Herrell F. DeGraff Joseph C. Hinsey F A C U L T Y R E P R E SE N T A T IV E S John W. MacDonald Lloyd P. Smith STATE UNIVERSITY OF NEW YORK BOARD OF TRUSTEES Oliver C. Carmichael, Chairman Mrs. Betty Hawley Donnelly Dwight Marvin Charles Garside Frank C. Moore Norman S. Goetz Joseph J. Myler Frederick F. Greenman Edward N. Scheiberling George Edmund Haynes Henry D. Sherwood Earle J. Machold Mrs. Emily Smith Warner William S. Carlson, A.B., M.S., Ph.D., LL.D. President of the State University 1952-53 E x O fficio M e m b e r s DF.eaFn. eHWill., MPraolvootstt,. President of the University, C h a i r m a n . JLWoehiwlnliisaEmA. .SB.WurCitloasonrln,s,oVnCi,coePmrmPersieisdssieidonentn,etr-SBotuafsteiEnedUsusnc.iavteiorsni.ty of New York. HCC.aarrCroohldlelstMVe.r. NDSeutawMnslooemny,d,,NACesowsmocmYiaoitserskioCnSoetmartmeofisGsAirogannriegcreu.lotfurEe dauncdatiMona.rkets. AWWFrriiatllhnlliiukaarmmWJ.AI..H.BMeHeiynnaeeigcrwaskn,aey,,D,DDePaeirrnaee,nsc,iNtdoNeernw,ewtN, YeNYwoerokwrYkoSYrStkaottareSktetCaSVtoetlaeltetAeegrgeiArniocagfurryilActuuCgrlraotiullclreuaEglltxeup.Sreeor.ciimeteyn. t Station. T r uAGseltboeerergteRKePp.fraeMnsneintctha et ilvl e s F aHGc ueeonl trrygyeRMCe p.. r MeKs eeunnnttgaet i r v e s C onference B oard M em bers JJ.ohDn. VA.mBee. leR,icCeo, oNpeerwatiYveorkG.SLt.aFt.e EPxocuhlatnrygeC, oIunncc. il. AJMIMsa.amarasrM.eciosoLndrRoeeJwloolHeeehlonlSlCsltHoahennveu,dneneenNtryis,neo, wgnNDt,oeYaNnwio,reyrwYNkmoeeSrYwkntoa’srtSYketLoaFrSetkeaatagrVSmtueteeagBHteeCuotoarrHebotiaolpceumeurlGeFatuterioBrdveweeurreaSerAtosaisoucsAinoe.Fstcysieao.dtcieioarnati.toionn. M eTmhboemr sa-sa t -El a. rLg eaM ont Robert Greig Halsey B. Knapp M atthias Smith EMERITUS PROFESSORS A T ITH A C A RHHJMJFCHTLWMBuaraohoiaarrmlabioliwsoirrrlpnsaen.rrloemteihktyrneoslaitCdleawymiSWOPsrCouEyoEsrHlAdhFCmriarLuvwieeyrBdhgegosaesBdaaavehtennrmeerritintBdkntdlnrBeeesslzuCgB,nisueBsnsBuCBa,slctBBrieorukoaluPBtCl.enatmlAidtnht,ysskaheln..,fa,eera,DrPBoirnyrwsMnurM,ha,P.e,d,gsoy.,rB.,D,P.hSoPnDrS.MthafeB..hSP.h.A,em,,.S...hD,s.DASA.cPs.L,,J.D.o.P..r,,r.,,L,oPP,r.h.,PP,.PfPrh.PDiPeoDrrrrn.PsProorDoof.o.soe,rffhff,of.Eoesefee,.eeLrsssfDssPxsoesssssPitrsos.oosoorteo,orotsfrrrrno.froorDesPfoPoofroseioor.fffoflss,oOofafonsDESfPfnorEreREontonrrsSPxiatonusualoeB-owloftmrlDarmofTtarrvinrmReenelieoyPtecoangculoedElonfht,HPrla,aig,gdannnaEluRyyluEogttPmsh,,Hlcu,mrobEoaPoEreoEgaEletadafrominryrmeliumtotgithd,situecneycsueorErasE,ory,ursiltidtiorm,itlEutEuoutguusEeEmscnyms.rr.a,m,meieettr,iureEeEioirstrEtmmnuiiuttm,susuee.srrseEiirttmiuutssue..sr.itus. ATGCAEGFORAHJJLRREODJJPHBMLFHLCRGCHHELREAPWoaaurhdea.elllsaolseorayialrohooedteamaomualhpoaeEoiawcaiutokewntilsuburrblotnalrwfmlLnhmgolrnphnrhnnaoutorlrmlapeefioeillereraaaeakaugysheCnhasionatnsadrslsgsuhrlerlagrJrneReu.WeurECrdtrrtddtoearndRm.MLAKodrsdBBddHsCGWrESHsWarrliVJdHeAmMoooatClEetRuKEonWhuhohodAeiSuNnteAisWruMrJaacagnbuolhecnorheaMuowLukeesvaeercolisnHhrinzluklaarrrdynuri.s,nl,dsgwtn,ceahotadasasaayleuaghereasslehslsdskieenceunciBotiAmrnaePPamtetnleoeronKeutnRssiPepudlHtidnlnlWEc,s.hshGnaslRnrglerSMsbhaLoNriRsofdWkR.o..SrT,ERtMneRilPut.DDesaHhWGenooT,T,emwJiieEtoWogtrsWsvyorRnlhPneariS,vonlh..oeoca,eaPrubrM,cadie,n,eeeee.rohehodhdeCgiyysyDeebTmtP,khrrh,MlralS,Br.HEPmhabotaPh,a.ehi,,leb,,D,u.,thlhtA.goMtenrPrDifvrrha.,rttG,Pa,y.eeMer.nMBSoBpifo,tP,hsorSE.PnemD.htede,r,wh,,r.B,,s,m..o,fofBtP.h.r.rs,hn,B..AS,yP.S.eoS.,eA.,E,DiAoPn.EBeSaPBDD.rP,..,PspSc.,sPn..hD.S.BDoPdnr,,SM.Ah.A.rs,.sP...Mh.ks..h,,.,.rtMPSfB.,,SoBmo,,oh...,.D,o,.o.Pihe,..PS.,,DP,f..rD.MPPr,nr,..LD..PPnfsASPP,.er,o.aPDS..ShrPPBPeDSPresA.,oPrr,i.soPonr.ohfP.,r....Ao.Pso,Lthoro,dr,.os.fre.,,AD,orff.,ftr..so,APSrofePorroff.,o,.Ds.PefLogfooPeDDP,oBCeef.sVPf..erPfsrsBehfP.f,rrA,esLf.reoMorsssef.,roseBserBsDo.r....e.,sosereosossas,fsf,EoS,oosPDoir.ssPoofsosoPos.segf,so.trcf.s.ofsPfSrefcsr,P.ofFteorSrsfeosrBEP.ortreoer,oeoors.o.e,r.osPeorssorrDr.cB,osrtArssPPfroxof.rsoso,foosrraofPSorfs.osoefPesoiffirtoo,olofo.fe.PfrobofoooEfrns.feeroo,oP,asierrSr,stffefoflFrnrsDrfPslnsoaffSrAnscoresFeosooooDPfsoeoEosansiPrfooRBsoDtfsPPeoaofigoafrDnsgoEoeorilfrfsyl.oCrnierxsioafsfrrayruoSesPmlfrforroZrx,MossroaoomtonnecsaBrTis,oEuyrcraesfootTAfcoiPomoforDsstfwatEeoefo.lrtneoerexefEuoosf,prthoePolysEDnnIfrcsimsoMarttoriRtBlrlSscsmcofnueaoEnierAssyiihoPtfidoErroo,hmooaRoonuorruliefdnlIggenanofrueooetEryglcnnnfdEiEryrrorErsHuocw,yrooutflarAcegniotaraodciyuo,Vfinhfsx,tgilmilBridoayultlIiSleuoTEclnomuFcrcgtaatuoynoEntoHienSs,EostoenseHeeHagusinnlomeErgs,Eygfgsdgbo.omemntr,rotitEmyoEcl.giroya,,unrcvuSieiyulardEtcnesEemh,mtoo,yxunrve,moEutgissnie,sesurAusE,Ednacmongr,tiybrilb,itrlEirEtdmesoEcceiteoebEacmourtnmriynv,g,aEat.ureuentafymE,rmEyglmlulcei,emunrynEsire,emoteErcEs,,yEimsetamTrEiEi.Esed,edarEierucecgtie.o,mErtm.oeniriruEEtlermrCrn,ouinesieyrmttEniuiriynoytmnasuui.ttErentremmlgt,oirEEs,teuom.ui,tn,giuctessroruoitm.umeturmsEisn..eeimhnrSs,,uuEpsmiterEEtr.si..rrtgueiseu.moeistasrom.uiieEEntmmu.ie.risri,ttsllulcrsntigvouuem.msr.oeiutsse.eire.Eigtss,ugr.,nscrruiee..eEiystmiiy.egtErsrurttE.,uni,i,uu.i,smettnmsgussu.ErEEE.g..ieissenmtm,mm.r.ureiietseEeeetu.rurrrrmisiiisitttt.nu.uuuegssrss.,.­.. AT GENEVA ORRHWFMPreeoateaartgbrocdnloiteiecnevlrAerdartaillculdOSJkgTJotsuoaCheZcsnholaltelinrrlefCnRltyeoGtPoeroninlaBnnoHnrrkyCr,eaMoieoernrtPtdl,gtuzl,h,i,enMs.MlDnoPPl.n,,hh.A.,,A.M.MD.D,MP.,....Ar,SP,.oDSr..fP,P,o..e,rSfrsPPoeocsPfrsrfo.eoose,rrsooffsseePsrfoossoerfssroosroosffoBroreofPsrafoosclPfofoaBtelrfnEaSartoicnnPeotfettPoelodomraEPmigtoanohIyoltntloo,hloovolgogmoEegylygsoyom,,tyg,lio,egEyEErga,mEmiytmtiEmu,eoeesrmrneEr.iiitrstetmuiu,utrssuiseE.t.s.ru.mistu.esr.itus. Faculty JLVDFAAHAWWLCooelinaeorrhovVohiFmtUaEPCPirttraslwhgyhhrntfiilloeaacnooneeetehieduutaroronaernAiscnhEsPmrrrvmnnntLaHoCotdRddaeoeWNtJWnilHmoir.rwlm.SoobFPonFIlks.Sl.gorrhtrioHlrinaeiSeitsaevaitacWynwwnylrayUgrsMigtrasin.damiirlni,he.eaAroonHiakaHnadg.nltronGrnainlcdFdlevgeet,nsnoe.emGrurMHi.nes.adtnertP,riTPt,eisitiddi,sybhnle,clyBiMePale,s.iGttkA,lDrAnsreyor.eeiSPso.ter.cncrS.r.B,,Ps.fhn,Me,a,k,Aeo..hPe.P,t,sPDnPiDv..aMghhsoGALDr,hnMa.or..ion,.DD.,.irsud.rSSMfD.c,es.PetB..P.u.ocie,,.s,,Pr.n,clrt.PrAsoADtooDlmAioDurfaaP.rfBoe.ri,rcestea,riresvasuearsooenosDoloeLssmnffco,PficocseinLtreitrErrstoEoPaeBoo.ensirfDsxtxhofoncruteoset.p.frotts.efDso,heiPofAPnsniPrer.feonsrPtet,idoohhrimrsroCosmmRfeseDePfoieneosneoiesninNMnilsrrFsllUdnatosieioePeiseednaogcgnnrwetnlnedSnytreiarotonavan,AstnYafrtgteooePcoiadtrefonloerHifnsoImmoonnr,inAAfdkotftn.eisyeheAmngld,RtsnSeHrirmssAetsuietaaosecatUsciidnnrraauEtnseatemddndntliaictiatosidinrouiAnvtoncnornrPPtenhagfieELorrrs,trsaToomxiitatiaibornffhtDcrtnaneieeyrndeeucdtssandi.aislrssrsotisDeooiPuSinPnuaacorrrreennrrtnoapococei.dlfnoohrfarreeeffSrEasAtstceoorsamxshgrsoPLffrovpsaeyrelaroierattncnghhcrnoiooetidineee.fft­.f­ STAFF OF INSTRUCTION, RESEARCH, AND EXTENSION AT ITH ACA , N E W Y O RK * PROFESSORS KAWLDRSSSHMyaaeeaaraaaDmndRtynmrulhnflmnfoeuorauoerpyeieenroyrnctadldnehrLAAdPBRteASmCCuaorasoArltgrehhyybhvkeuneenlieeuebsrnstAtsrr.rotrthueelBnABidBsArcl,arltenasrsiBAePcnnddeAshokheeenloltl,nssr.,ewnlDs,,d,nP,oMo,.,PPnhP,PohP.,h.hPdhSDP..h.,hD.PD.rDD,..o.hD,.D.P.f,.,.P,,e.PDh.,rPs,P.rPPo.sDor,PrrforPofooeo.rrePrf,fsoffeoseesrefossfPososesosefssfsrrsosoreooossrPsroofrrooseorforfosooomfsrofAffoFoofBofnrSilABeofiiMooolOmngodiRptylifaraamh.nrunlSCyPkiarycstrealHlhiioatceloaipunPsnnlns.sSthcog.bdoeyg.Ba.csyniiHroo.delleerooaydggd.iyyn..gof atnhde Head of the Department. * Staff mem bers a t G eneva are listed on pages 13 an d 14. DMIWJHDFJRLLAEWERCGEVGADDCDRMWAHOCNRSMWCRvoaroaltldelaiayhalooaeyoaoarreirrcaeaattihiaDLLoHaiacCSeDDLSSawcwvtdttwnnvolronarnvlfrbllbnondrhxrhhhlnnflelhidlfbtcretearerliidnvenMiietieeleeareltileabaoaeuuneaiuudhledaaaeaaileeaeaepaaBirlpClcrperttrnCrllErDbldromnnlrrrrddymrrtdnFeteaiJKldldadsadaHdrCtcoBoleC.adeWecLerrHaerGCrCWTBTHBGkLeJruDlmert4OLJFewt.retCaeKBnoueWJ.BmRT.mnmlFGBahhnhdorre-ri.xdreroiofleeaoaoreiheooloHoFynnbBerteeaebeeaErhaoBnrterlmbveathifeysrfavuBwutefoolaasnlrdeorisetemlrnHHnrtmndhuiindrnghibertoseGdgpnytmsddrrkedNxCunocBDtCetCeerhAyHctnteaohutsreCafnicp.rd.oolkr,wsuBrFrrlh,oi,uya.riclHynretrok,GgorotreaoBuinuuFHCHaDunutehntocePCesDDMhuolPrrCnf,HraCnblnHFlrsDPsdenree,nliteeoihanfoHHelimh,uaihakncmo,o,Dtl,.tCCrieAhFcPdsmnal.ctapliACyr.nheLcouM,islDdCa,ykaiB,oB.DiklrekkhMenerPlragyasnkPDelwllouret.elhaernad,oGb,,.,s.t.tPMn,MguArr,wlh,.rzn.hScarDa,Aunu,oaSn.,,o,e.t.euierh,,eh.Pe,kPFrdhm.P.PMnsdngrn,iDPMnrdr...rDn.,DgalaBr.gA,a,PBeShPee,e,h.rggdmrh,,DPoPPa,hft,mre.olnM.,lriPrr......hy.,.ft,.lm.liSPrhlS.c,SDhP.,PPDnSLo,.Df,aJo,e,cPlD,ro.PPA,,Pue..h.,.c.frDrPort.nhPryun.DA.P,DAhf.DSM,Pr.hPeoso.D,l.Ph.,.,gPf,e,..PhrPol,,,,tDs.Mr.so.D.fefh.Ph.t.o..gDse,uh,oDhPo.f,.she.,Pre,PPDSufsPDs.,.SfnBr.eVProP.orB.fs.sr.Dr.sD,r.rrechooDP.,iPDraSstePDP..os,Pfsrrooh,.Aoa.c.Psso,.i,r.fsiSelsro,oo.Sr..,rfsrP.Drrlf.Ps.fun.e,.oo,f,Possh,oeoogD.f,rroiee,PP.oPeArso,lrPosrtf,efsi..rffPfsAsroftsrPPoisrrEPe,oDnPfr.eoseresPorueiBossgnoo,osrfofosrcrPossrogrsPsrSofxosfeorforeoge.PffrosoPoifasooefsusfEsre,roarsrtreeoPnnfsoferoffbeoorfoosreoflFonlselfAisssixseetoerroFaessPrtcrrnnfPofleorsAtsfssooisoaussstEosfosenfsoAoe.sngrsoosfroerrssefrsfoosrio.SsroofpMsosotcoixrEororrenmnorPsaogsrofofesRoffckiifroftBssrrsorloxrEecceoSonsePooreiafsofioueoPrnfPstuEoAutrVnsuofoofoxraooEMeroorfnPsofrtstlkPolMSlsilntyxrftffnsPogffaeatltcAcoaFihtfreiiueouDeul..tnarnsongorleoronrBnoaeiBoaSBtyrfPAlnSrniirSFy.efenniuatvnnltsorcefauEooeionaerlooicl.takoiniELilmsE.uHtnalodsyasiforgtircgtdgfPrSZlmeiiiaesvnllryxibxomenmenayuu.PottmaoynneEoBiSCfttlOuitiHmnelT.ctcgsreaerycecnoaIaehnnosrvrebaitneesHnnSPru.lgHlMearsnoochogtiot.naS.ocsvsCdasean.cliapdllouiaguinhHiafoibenoortaeuntlosrMocnlshyvs.rdmnEnayngogo.seAuenbnvbd.oiFSnor.at.yypagen.casiaearylsontdlgs..rcyebgonynnanoAsiS.Soerde.gaian.tiaddgtyneeidsmsnayggnasryr.rtsreaAld.yetaynvdvieeinsnrmE.icdisnaraHcytdctassAinactneeen.i..noondSsdAnngAdrntttit.aatasaomsiSHnHnnscHtmsaitetdadiueseasneiltlaaSctt4aadtaedGAdsuAt-ndnaHrtesstLteAioosnseon.eiiffSecSCfssatt4ttttidliattaatta-cunhhhhnentHtsbgeeeeeertt. JJJNAALWLJFGMLOGRMEHLCBGAMRETWBMWGPooooreoaaiddhloeuhaleeoelulahyhhseneyivaB4Dobipaabouuuwwoaoorowlarrbsleldrncrirnnfll-bfeatenibrrllavrtrrmrnoepoeittoHsoiaealeyrggrlgroaieaehinparFnFhentlttRLrntrlvnKnPaeeemurrrAtehmannidsaMrredtscAacayWareHDaeRdeCrDSAFuCeBCAmekHuyDtREKdsdelFANAglaLFmorleneoHmlapaaulDlaeWbeu.maborHayueaveaxBrtlaussmoredtrerndbeoL.y,bveomsinfroeihlpwaiigMorrmdeirtlneeecadcrtcbeinpelJmnnieluhlwtedlorsHrnilnektkreLayLJardLaaroi.dcls,Kortncs.agsroaglrJaieHoerKe,eoKniJaJMenMdtchtLLheiLeBaHHccLnoraemfoanuLHokePnnnenyHkaasden.duHcnoaKdaomnHfeSlHKMnshdl,seFwroiessosfetyifuliMgn,so.in.er,zemeoHserfbl.loun,MrbLMDnroniahteoan,ser,ytnn.dyePscatrP,agn.arefcadoanytr,P,.,k,tdn.,,kyaioMhi,PiruuD,snhS,ny,dnPri,ccM,csd,BnP,.Pnsb,.PhoP,,.P,DgiueohP.DPD,,Pe,Phs,S.ef.PhPhhBr.,tSl.nPPDPhrhe,P.Shn.PoaPhD.ot...h.B,h,DP,..asADuh..hDhD.hnPg.f,S..nhrDD.Ps.D,l.D,.he.r.Do.PD.iP.a,S.Pdh..o.,D..DDPehD,e,s,,D..,.Pf,.yr.r.,.rP,Dh.,s.,le.rP,,o.DoP.,P.r,.esDPPoDo.,.Pr,P,sa,ofr,PP.fiD,PrhroPPsrPrf.r,enonPrerP.f,.o,PProePhooPrf.P,ooSrrserP.sfdoroDrofes,rPoofrfro.srerfsPfsroocDehDEofefssoefPoooeeffoossfr..fesfheososs.OfPeef,eo,ssfos.xfrrefres.SDsoesseSs.refssesosose,rfsrotsDssoorsoPsrssoPossooeseocsfsr.soonAirssoors,oioPrsessrrnrof..fronflororoo,,aooeosrroosrforrnsrPororoofmrEsoosArfCfrfifoEioPPPofefrosooierfoffmoxofonoofnooooPrefsPexVsrrflnfftfAoAfoafsnoffBssinErfatuelRPemePofeosnfEoaLsfPltnPbgniNgAPesSADegonraloeorulfntxalslstasrrauosHaeBrelrslfaoniurgtoiiiasltsnooBnvombncritRoaccenmoituraoiraovgofdBfHtamltrPNluuornnrcrtorsubiynifieAtyooncllsctorbtDlioPAlaP.ureStteEoloeioifPEoeeouuaaFudlorSoodatraoeIfgannFmcatfrnlilrdrmHgititnnencidyiotHiio.CateahanhidcCuryrrtmidhyni.lBEolnnllioigoyovyurrnou.cad.oSunohaooyldr.ilaldolaggnsEoElcsnoieoenttmpl.CotubHstiy.tdegurmCgcga.nnicfsrtgvSca..oyihreGyrny.uyggurciayineBat.ne.o.ysc.siislaet..dtmnnt.pbte.iaiint§ruooreeoesnayaeiyrcn.eesnnadnt.e.hrrti.n4d.drcii!enny-drHsamHy..ggnDe...AidsaiCtrsdreHsylicuosetbatfoaandrntdLhtooeeHfSaf dtDettaeahhterdeee.­ Clive Maine McCay, Ph.D., Professor of Nutrition. HJoohwnarIdvaBn aMgnialllel rM, Peehk.D, .P, hP.Dro.f,esPsroorfeossfoAr noifmHalotHelusAbdamndirnyis. tration. Wilfred Douglas Mills, Ph.D., Professor of Plant Pathology. ECdlywdaerdB. GMarodonree,r PMh.iDsn.e, rP, rPofhe.sDs.o,r PorfofResusroarl oEfduFcaartmionM. anagement. FreCdouBnitsyhoApgrMicourlrtiusr,alBA.Sg.,enPtsr.ofessor in Extension Service and State Leader of FraNnuktriBtiaornro. n Morrison, B.S., D.Sc., Professor of Animal Husbandry and Animal ARRHCLLCHKRKGFMLRAJAJGLMWAHGSHOJESRLAFRCBGGKCLaaoeeoraeohorlhooldeoeeaeeeeylroearoaeedrumemilaaaehmpieoeepldnypDcwrtaloaobnocanrwbnardbrolrrbbanrsxrnnhadsneangslhrnalfarrobhernnerirenerntieeneeseieninoCeynkdllaceuraggwauyrrgiasasslaeSrorreenelPerWprtdbeetrtrrddneTverrltsmettGmehtrtsnsmJmtitmddti.aPtaaHBdACBLcthhMclMohhaBaFJLrrlABMoJeHMEDAePkWSreMokiEeadslneNtaohkolRPHoACotVaioienumhndGfoaeePrnpwrhtatdimfdeendhLukosoeecidEenazriteloCtrrmfitererdato,Farclolem.elnknaeemreE.ronhetutgrrotawelnnulsneipahrnlMcssrrhirrTPioRrreoeabPanlsnrStpSoiccgruaifandmoPdhhTaddt,rusnlPrfacnyeytohefhhcam.NRemnnMlceyundSn,NoeeRkttrenelprroPr.nnMekdtiDaRrneStPaemwDPa,adrriPSnNovoiShudeehpPSbtRsrrrTNyToTreNtoSaahiueernihc.Reso,hyom.PhtbPwRoeeSRlt,lndriDaSlui,eugrh,honlPS.,reole,saly,ediwhraoeuDiow,otTauDyPpmasrrraowrvgyrPrrmma.i,,yl.PP,mmsaSPknPgn,t,nsmPs,gh,phDmhnri.lePrrose,oavhhs,onsiay,hieetkPhbBahlPoh,.,raP,InnPhPpetneaPc.oerD,e..n,vy,rl.n.eMe,f,hnh.Ph.DDdesnhkwn.rylDDa,nPh,,PDShPeP,ai,rrDd,,oo.,.P.Prrts,,.,,rP,Ps.,,gPD..hDn..hh.h,a,oD..uMPPffD.,tD,,PhSshPP.,,Ph,ehP.refmdB.Pr.P.f,PsPPi.o.hDhD.PPD.PoD,.h.de.rPhhs,.Ph.,n.PhD.Dth,,hPP.,PrD,hD..hh,Sfsres.rPh,Sh....hDDr.Lr....PD.erroDDoyPrDs,...P,,.P.Dno,Do..PPD.r.A.o.PooD.PDDo,,sPo,iDf,Dh,r.,..orDrfrt.fmr..r.sfeff,,Prf.hPo.,rPP.ogehoe,,.,f.o.o.P,Pee,oP.oe,Ps.oDoPP.,,,fe.rss,rfnrrfr,.PVsffs,oPssrDrrPfeProfrDoesPPoo.efssrPreePossPooo.esPo,rofPsPProooosrfss,fPrPffessoorr.oorlsrofFfro.Vrsofefesooree,srfroofrrorsso,gMoeersrrorSerfeoofofsePoeosooflssfrooooffgoesfesfeesofsoesoPorsefssssorDfeerffreorroessfoefsy.gsrstsoeMosseofosoeersiofrsAsfeesooassfosoflsfo.s.osieosorosrossssrrofofssssoSsobcrroorsrosfPtss.reoaoVrPffofsosSfAofI,ruafPolcrooooroeoArsoroorrolnorelrorcobePNl.roosfsrkalrrDVfgfaPEorfr,ftfBsiofnafooogslfofonoulneeoorfreeuoCofBoxaenoaiffRrPooeofiGPonffFottrEAftfAmcftVcigrtfnfiPttefftrFofclrfrrCueaIntPPeanoauAoBEeanZto.ePigMyeatlnePiPnoBroBrbnCMttgfraralltEBnespif.lPnoorgmorinsataiafosallBmylnes.niloiertaucoosneImtaohealeim!Ciobndtpceo.seyHoenot.emrrnAghcrncntlytacslfudsterekP.ohdoomaasPdonSeytt.olCssouth.CndeaileBiemlbglieauile.rPoctolcroesnodlrrooiitamtuyoalrPrTHrsCacbnmmfoiiaighEogeliolgnvecodnortgoanliHotgapyeoil.rrpuanoeytdhaiaFalafgtcoygggonysa.isloCEhldslgustlonlac.ogay..y.tpocd.i..Bgbo!iarinsllSoerdyrg..ghsEnHnryoyCoalbnmton.ty.yyogieo.gEnnapadautnh..Fgemaytgdmnnassgeiaaryina.Mi.tbnrHddsmio.nnfnsb.nyynhadrlidderae.digocyneFysenas.gr.datoaHrfHy.dHarVynirlrygnoye.mdeee.Beogga.aagmf.dyiddeoHS.ettluahoeonoobpgeafftf.yldeeD.ttrthhhioneCeeeftpreDaoDDntrphdeeetse­­­­­ FJJAMDHRHWSTREaoothloonoaamahaiioEroybzdlrrnnxrnflooedamireailneasblleGilsRRddtaPmdwyetolsMuCoeterBhHArSWtmL,nBaCeauletnrneyrLilaCurohrnntotpiiehbaihWhnEdcWnntheobresikeeidtyenoniriWuVlfgWWsgnyZWlWcWogmtiioeaonnnaarWWelhftaiinnctsllilgkeincooelsWPtiah,iWi,h,lernnarnult,,,rtmi.mP,PsPb,leaPl,hPPhlharPnsiiPha.d,h.nhP.c,hDDmD.h,.,.aDhJ.DDP..Dt..sMrD.,,Mi,.Dh.,..o,.,,,.,.PP.nP,..DPSP,SPrPrPsPrhDor.o.,o.r,hrPor,,.fofofoDe.efreaPeDffPePfoassnesre.essrsfnr,.osssdsso,oeoosofssosPfrforeooroPesreHsrrrfrososorosoooessrfoofftofoofoafhefrffeorBrAdseEPsofsPaADsnoolodfoCcloaEfifrugaatEmfnroecnicrFAotxrrloiaatotlyicfathnlenotfBeuriPegoilBnomHlImorSeamtnsenigDutouoieadhiyoorMccsdclaeuoa.nfibhinpolslnHaeaoEHtaldTgnmornEgurny.ogeadtyntHsim.gaymosr.bgyct.emeaeirehm.anynnoide.dtEnele.orngcroygtoif..nyan.gntoh.dme iIcDnsfe.opramrtamtieonnt, ASSOCIATE PROFESSORS JJJJHHJLEHMWLLKCCRFFHWCEWEJRRCGSeaaaoorooletulvhhaoleoeooeaofmmmoawaaihiihmatruugafrenaolrrbllwbbwunyrndrrnllnllmiiloeeseerrryeieeeitaiessdfrcilagLtaysanoassaooreennrreyteiHarremCmmiFdtettnEsuJ.srcradHdonLDED!daJeacEeanvWCEnSAEeHamAGdarMrrarTiLREJdaaWwmnraaneeNrrwGvvolieerirermaamrtt.ostbgeciDilbetohomiHraeslriiAnMswdhbebalniereswuErwnnDmducBrBDeuiyyegtaeroEBenntdaehtBbsttGernernaDareloChaotdrcrwrot,rFSrtwfDkcuantoisknheFgiBniBaBFruEeheBadrC,EPneiwsreleerekCer,prrheiuldgonlhrelarFrore,CsPddCaeellwyoeotaontenw,ad.P,higmetty,shoDroMfoaton,osrtiieghB,rvJt,,e.oPnBctend,MtraM,owtDr.sre.irtP.hni,n,,rMkh,bnDPsP.Sh,n,ugBra,,P.ehem,o.l.e,,Aha,,thP.PS,dDiP.,.rPP.,.trhn,nlPSP.S.DPrhM,ah.tslhAPDPDhh..tAP,iP,A,.hnhs.ADo.,h.,f.,.h,..hPDDsohD.h..,i..DD,.BfP.sPS,s,sD.eAD,..PDhAc..AsDD,..sohA.D.Dlh...i,FA,o.Ph,SAsoA.Ad,,..sacD.s..,A.,,cssD.a..h.csD,t,AissAsAD,s,,.VAosieao.riAos.,FsAAasso.,aAD.ctsmAsoAcss,c.AAsoio,teotcssAiPs,ssosesicsiesAac.cssorsaioAasssisoA,orcisasbstiiostAPtcooasstocSsPeaciaocisoetPsoeecsooaitsrcnciAeftitoisctrsaecascisoreateoeccaiiugosPoiacetiooPa,atiPstfsiitaceoPadefaticePraaetstecfsrPPrtieaeteceoPtriyePottoeaiPsooreeatsoeePirraPfsostcehPrPfrafrsooPteetPfsoPoreiePreofCo.terPPreffsooaPrDoePesorrfsPoorfreerossrrotorfesPsorfesforPffesssooorP.efoooeussofosofeePr,ossfoeorffrseorsseEfrsofrresfsoofofeersrososefssPoAsresssfeonrrsossofeosfsoOsreosPoorsrosoessfRetsofosrsorossoffsrreooooosofrs.csoorfosrofourssBofmfsrroueoorEefAroofosorSorVcoafloosifrooAfaoxfErfotoroiognPfsoRfforearflltPfiocnfZonroyEfoEoelglftPoFuihAoratePAfiogSnofgcAeBfdnoomaemSrnAEHfolrsnoyutmtmnuamrIoLaaPanacAtiolxcaigolmnuiloccofnSpibmirtomaoimtliarlespBmstuaonogseholtoolnleEnnebeaOttioloryofnaHirygnrMdracoiccdealaldePg.lgliTsoyy.olurgetoosCulneuyiay.nn.HaMem.syHloEglCdds.tc.HtrMoonaaEa.hnbyuicuroayuiugrmlncayonua.ocrtsp.osyghrgeiT.nlrgbnsoAbesaroo.oe.i.bdiopa.efnnatngnmbdfaonrmhantg.yeiymEnardcooedei..dlhnrlcnlriaroooyrnystiitnoynfgnH.g..i.dsm.gygyIot....nrorIastlntieoicfcogoutnysrl...­­ EHRJALMAEEWCWLPRWAAJWDHVAJRJRELCFLGPWHHGWOFoaooaodaleorllodaeoorubrhorelalesmiemuailiHfisimHGSHhruaarswibmteamaitbltruliulwbanabrelorbrollirihlghteltvnllrlndbdtneaeolasuieesleinopuooieoeatryitieraayiuarhsaisuekaoadmreeYuneihgdrgrslsarrthilnarrrEttlmtrHrdrmmtirdrrdtnbGretitteeRmMmPWdooMWiSoioCCVlSDSaMNaARcILceMilHPSFCnLuaeGiLDnrt4nerntB.nGRtceEEauniAeroieOuiWa.neuiuuaaere..CrHnacu-alfcouhdoWerlollrrelramnoolLNmoltgsnptlHrobrelrtwridlcwmygrbmsrimarlarSnlealoulbnsrrtodhad.omuryMiioetewKeiieeruuholdn.wPekSetorimoecamloelao.oepr.nryHnSClinelmenudsloaleeirdimrynnorLlPyainoneltlMigtecN.atdlaetnnllrSuPlnSrinrdorRrelualHKhiatmMscKHOK,oetPcSi,hetJNi.hMKranLPbNStnuhdhShaGoeKPPgskaaouhimtMoegteBnlodlmeillmePh,otcnilegeeohMotiayrHpsevlwLehls,elal.zlGKoaiinlhRdae,i.tyaSnornlsMrilaeaestpys,k!p,etRyimttis,t,iih.oiP,r,rsrr.trrro,rtalthpssesDtPoalep,baeuedma,,llP,n.oPtelhy,csnAPr,s,Jd,AA,w,Ah,ed,,P,ylks.,eneoh,.,hm,rPBPe,ohePrB.soD,B,osdhPPs,..PP,,rB.JD.,P,r,JsrJhP.h,BDk.hsnDcoPv..eArhDh..Fhhe.oPrSr.PhDo..PPSMyhh.,.PA.,PnrSs.hD.D,...P.,..c..D,Ss.ch..,Dh,D..,,k,.hhDAD,hd.,.hMD.,Ai,ssDhi..,,...D.Aay...PPs,a.,SoD..,,P.PA.DE...DD,AAD.stD,,o,.PAAAP,,D.thAhc,.se.,hShseMABn.is,,c.As..Asishh...,A.Aonsss,AAP.,,.s.sa.D,DgisAs,oA.,DsDsAs..PsAacsAsoSP.stoohsDDAs.scssooSAoAAeAosit..ss,RArscAs.rs.cc..so.s,iaes,scco,ocso,.c,,sso.D.ioaosiosiosssAstcAa,s,iiaoisocsiafPacAtesfscAAscsoaaoaAcAcPiasAdset.eoictecitoo.Aaoorsiitte,itocaicteoaeAs,rsaiissacseieoaesssatecPcsccitaioocsatscsesssPtistsotaAetfaiseiisiPMertoPaeoitPiesofooe,aooaeaaPoPPtrcetsaeoPaetorrcesePtrccrrosttctcoiectrAtrrfPPeoserPeoe.sociaPisiePPiefiorooeiLcoaPosPaaoafoairroftfreaoPsrPrsfrioffateePotofPtefeotrrc.tPfoPstsarPooeefPesPeeereeDertsooressffirfsoertforeossfsorfrsasrPreesosePefofPoeooseeocsosPs.oPorofsoftoeePssoPPsf,ossfPrrosofofsieoePefoffrffssrrsessrearoosrerrsseoeusrrroeesrPouoorrssosAoooostoosofrAossssPfossiolPfooeifsrrlrserfsffrofoosrntsoornfsestoseooffoerrooeerornsooerBfoforssfresfioyofPorsssosyOurfroiosrronEsAssrreEoiosomssffffPErslRofofoosEocsooerooAfxoooftrHoxHnoooooflrnsxicrrfasOEfrnVRrrufftfFaaPrtyoifffrnfhsEeiultoeWueotmxrtonAtearuoorBeooBoienPEseosfnhaofodBsmtnAEfnSHtHrgrsmurffmbasenfbioilisonffumAaPaAoosaolooceillaPnigEauiuautldDoioicoVtclmofriomatccoPRonsolsgrrgnrslsllanHatnflthnhntoymitiiagdbeebMnolorEhdrebratuNtcofrBeaeofPiiriuogyyiarDageyfonlrlSucdorerncimoTmnyHmeahmnuyo.Tse.noyylatsueulluanEto.bHnyatetd.oHttdli.MsliuerilaoilcaSurosagsaslaaocxCvrtgrrtIauisbtaBnuliutgelryuyngyycSnrttairyoccbrrHstalyrciesFyyr..rhrdSe.yodnEiose.ghobvaalabeenaoo...imirco.oIuapyniiannnlse!alnsynifncincgCrssE.hnatnddodinege..Etdoi.tgoeEnedalOiiorrnndr.umonmcnnoryyndlnrVgtratyogrsaguygp..ydhgoinentgyn.olTs.inaA.reilntBdnay..dnoycneuePtsme.iaege..darosoBeIteeIrycielniruinrsoa..ohiAnniftlinfgnnatiogltonryngeanga.ryry.i.gllt­.­­ RRFHDPCLGRFPrahrooohoweoeeBuiwoabbbwdldilririeeegeeoplgarrrlehJrEmreltttiostdTcvesDWEGHkAHeaetErlroipeaziliaeeHclobhlhrwrltbtsvrsenzrtageowier,ZersrUetrWyrroowtPyhSWnnrDWiUhetnpihSr.tWoehcUDam,etbuhllulT.diheaslDg,,tlitirnlkzhlnen,,JeaA,,iogrgrnsp,PmPs.tPP,sa,oshhoPShhraonM.n.tMs..thDcD,mDDe,,i..eD.a.A.Me..F,P,lPt,,,ne...hA.,h,A,AAtS.P.PDsAAD.sAss,ohssrss.sso.fsoo.,ooA,ssDscfccocooeiPAsiA.iiaccacss,aaltsiistoisatteaaesaeoeAscnttotoreeiePtscaPPPcsirtoirPPrraBeooPaofootrrcftrrefffooeePioeeReeaffsefsrssPeetsueosdPessssorsorfooirssorsnearooorrPofsglfrerosrroeoo.sofoSsfffoosofrsooBffefoBSScrsooriAFioesFfootoociiaolnollsfoAoronrhifgnegmyCnePoysdy.Rroilaft..aymarnlurynBsyar.BHetalirioluEoPvHlslodaaSobutgtugoihasiocycbcnoani,aadloft.olnirlogoydSnyg.rtyy..a..tistics, ASSISTANT PROFESSORS JRHAHHRJLAJHRCLCMRCWLRBWTWWWGMCCSoootalahhheoolaoihoeooarearoeheihaeiihvmPcocwntnoreraaslbbabbrllwwrswyrnhnuihsnfnlllol.bdrorrrnrleeenyeariidodulygellaalmaaaaieederrrrtteeeStWEnsyeerrrHrimmutttrStnhGrtoRBsssooddHdtlttAtlrcetalrJolCHiLFBiDenuleWAaoeoezMlCfeLWaiLAALGowE.s.CalnGenihfgauiwEnrinnslrayocreeilnvsaauEedbyaSiaotgcieenndegdmkeevmlrclmersm.rierolhnoetilydl,nrsleluoeBhilirdewatilleerneogawoyGyfhaincp,ingPoswHanronninFABn,mBBDahloeEneyaAhhMlDtsAerLtarChlaoddrreaP.lEEioayCyarmJDmtFlEloooEo,nmvA.eCnhhimncovnvShsDemntridatG.chHsc.AaMahhsmdaaeio,a.dDasarroknl,CFn,,anirnrarstunltunneaelAneneoe.,egrel.,,osnnln,SmPsmrAPd,clsoris,yt,,aoy,ns,P,ck,PtMteB.r,hhnrdBsPs,A,o,inteekBPP,elkPh.Pl.Bges.i,PaJnhsDa,DS.tu,lssAhhPiP,..,,hSho,Pcsr.hsSstDt.rs.SP...Ph.Da.he,.J,.eten.csPPhDDi.,.,M,DD,aM.nDs.rn,h.m.snhk,,.A,.hhDDn.tP..AiADt,.,.mA,A..,aA,,..sD..,A.teD,MsSA,h..DDSntPcs.,A.,nsBPsyAAasMA,..ABs.st.Pt.ssriAD,..s.tPen,,hisA.issAo,,FissssAr.iSnssr.itsP.t,s.ssosis.AsfSAB,s.stHAaDsgA.stAs,itssei,irai,ftaiss.nPastsBssoisusasessM,ns..astnisisttnttAAAs,iAr,sstfnsasrss.asasanttstaoSietoiAestitanit.innsPntsssstAsansAaSfosssa.rPanPttstsststP,tsetnrsntPttauran.saitPriisaiaorssoo,rttsssnsroPPPsn.PotAnsinPnsorfrotfotttistPfitAoerrrofratPaaatstPfrsPfstefoooeosrefFnortnnonaertsrsPsPsaroePsffffPaPsoftnostftitlAssoeeeseonrsorfsseonrsrfroiftoosssoesfsoorttosPesfoonPPetPrPersssasosrffstrfisfsfrPirrooorsoeornaslecPreoAemseosPoooaosoorsrrrsnrftousosoorsrfoofffrnsfsofgrsaotssfelreferooeoooforPootPtofoolrfsssMesAffufrrfPoiVfeorElrfsorrssessocParHSosfoorRfogosfEsxaMeofeuooVsoonPafooorrsrrrur.tgofunfeflRPftfotRoilfeAkretahselsrteoaroounrlnAVeuoogbrsusaPCoPtanfnffoAorkstSaosmoferallrnalieoaintofimooabercftAmaanngoFFtgltfiEoanrlthgiElnlPgmdynMroileeenblaRsooydBnioEtn.roVa.ntroeEliElcfaly.aurgeutmetaTgrcnCrfoulheoiddPb.esHcvr.reycgOgelgormatkeuualDaaH.aCt.uroiayeuleldueltcctnrytoolpchr.irutsinitarate.aHooaognlhibsSoCuastatoenwb.nnpygiiiballroumrrgogonole.s..noaiciseyn..ngagnn.Eidnepb.on.y.ggnsdrnaClad...y.ontrgnar.ygdioDdln.yrpe.yiHsrIe.enrociafnrtontogridr.­­ DGCRJJJRJTTRRRJDKWREMERPWCMWWBSWSaaoooaahhtaveuahiiooooiiaemmeaahhiiiiimhccicSBmlHunroorseanublbbnnllllbvrrhhnlnhlolnlslllleemmrrrgigyieeeniuiuiiieieeieaaleaeolEssaaaaarll.rrCLeseenrJileaaLFrrlrstaAmmmmtnmtttltBbdsolttdde.ddsslRasWaehAiawELdwhRCePiDrTfDnoW.EnnFEyJRaFKnfPGnPeKLdlreiialnhigLo.dtmsosdairevdeWrcwnaMrumeirinoan.rilareredndwVlrkiniLugdnenddyeldtnmnsioSbdoiaaihcagtlaeNngoanwoa.aclnewyketnnlMGSvilreLatortincdl,sKtalrMohrLedTphMslenieooDuJeWSRPtWlaRwc.eo,hSeoShedwnoM)gerrYhkShoeioWrek,otKanoecpeirfDoieofm.rll,Kby,oddbWalphlMmDea,er,oJirMle.ie,rroiaoenncP,y,yaWuErlPdnk,.kPprPl,kwnaa.wcg,,r,hni,itPhdsM,P,wshkrl,heras,P,iJ.sAosMl,.o.nhthdPD,r.Mm,.iDre,P,haPinP.DD,Pne.Me.gs.nSJhlDPr..Dh.,,hsPrh.Arsa,.hPDSer,.d,...M,S,o,.hi,..D,,,..h..r.hDP.stSDMsD,A,PnD..,.,,AM,.Pt,AsPAA.D..Ph.D,ah.DC.,.sPi,AAiA..h,c,h,.MJhsAn,sSnss..s.D.h.PDSt..,tAr.sssAsss.i,tEAC.D,iaDs.AADs.si.siAish.n.,EDA.SnssssPst,,si.Aiihs,A...gass,.stsitstss.t,.d,Drs,sa.saaa,DAssAtAnittsio,Asias.staanAinsrinAAPstAs.,Asasfsits.lsn.Atnn,tAtisttSsa,ieertantssssPsastssAttssaatosnsssniicttPAsPsPsastnisArnsnssafsiatPss.isitPPionirrrtsteot,stsinstPsLtsisnsaoooarrtsfrtsatstsrtPtitPsoaProtenoanfatffaPasatAsinPoiaePreneasofrsnfofnrttntntsrPtoPeofnrseessaostnhstrfttorttteoaPrfossssasosfsntPrftrPfoeAsnoeosfososePinrPrPfPootPersessorfoosorertsrPPfotrsfrrgproortessosesrPsrrofooasorrfoososrfoorooPfessPooeRofrnffofeifsoorrosffsforPeoerescefrferotsForoffsuorsefoesssfasussoDrofPPoolrseosfrsssosfsocASPloofoofefrAoasoselslorotfakorEooraafrsfosuorslrnrrrAiioonMfAosifnnnsoDrrrrcoilPoAffiooSoVyraomtoottnfufBmneVoaaorlffrolofSffDisslaeioBrimaPfamEItcfBasmecsrEkgonMfouAlAAnRcaaiiyolrigxoFooefasetnftereAdaitHrFgneeguttlhearttlltonHeglueaooaiaIPytrAPrigor.rrordcunianninmHsnogigbikaueanGoroleliccsbgtgdstyyyfoaIlilenstsr.eludbauuiecl.hneru..to.ngytbgoeelPsiraEliulnoMdsgy.c.atrtyntnbMnrletluCuuidHy.un.oCgtorandetPrrusu.ydlrifanT.gutgraarttcoearce.rryodurysll.easstykpaoyp.br.rhaslt.seryEaE.soaociaot.lo.EhnnnrilnlanonoiggdcdEnngog.giiordnynngf.yynP.eeg..oFeeoi.Pmnorru(liierilOannectenggrssrny..tt.­ INSTRUCTORS HEME taaharrerlotlliWdnZioCLleliulaodBmuwagiihlCge,yraCI, nnoAseht,.BrnuBs.,ct.atSCoe.,rdutrIi,anntMsotArr.,uAgcrB.it,coauiIrlnletisyuntrrHauRlcoutrEortaonrlrgiiiunEnmedReu.rcuianrtagil.o nS.ociology. RWWMaraaysyl.mtneVeor neLGdryarluTeHbh,FaokrmBya.a,nSss.B,oF.nSIon.,xFs,tIornxMus,ct.trSBou..r,cSt.iIo,nnrsIAntirnsugtcrrBuitcoocutrtalotnirunyr.ianFl loDErnriacgwuinlitenuegrre.i.ng. AFrratnhcuirs EAdswbuarryd LHuieltdbeorl,d,JrM., .BS..,S.I,nIsntrsutrcutcotroirninAgErxotneonmsiyo.n Teaching. HThaferooorldmdoarLteieosDnl.iwe iNghotakReisc,hParhd.Ds,.,JrI.n,stMru.Sct.o, rIninstrAugctroicrulitnurEalxtEendsuicoantioTne.aching and In­ CBEGreeenHcroneirolisgcrtDeeti.cFJMurSoelhcatduhnrergureatiS.tcr,cekhtIunSSmsccthraoucattchu,tfeolBrer,.rS,iMn.MM.AS..,.nS,iI.mAnIns.a,tslrturHIucnuctsosttobrruraicnnitdnorRryBu.iornatalnFSylo.ocriiocluolgtuy.re and Ornamental STAFF OF THE EXPERIMENT STATION AT GENEVA PROFESSORS RNJJDJDJPRGGZCCWGaaooaoiehaeaeaeemmchhiullroooFlvalshtpnnlbleerrrriaooadlghggussnrSneJreEeeCreosdeMDWBsiJInavEnTJLtmBaoireWeaosrdiehlcHsurmonletrrwwioelogeetvtenaaoC,eobillnayerrsalsdnKdrhtoiPPstdnoSHCaslSehHegdHrhDpSdr.laaeRtuaDLatmeaoaineePutocnryumn.aSesdalsk,am,rzcn,i,c,onleeis,k,PmhlaPn,,,rMMtPeirr,P,ohPnitooPPMht..n.thhPePSAfeeD.,hh,.De..rdhh.D..SD.sH.,,MDD,e..,P.s.DD.,r.e,PoP,.h.,.P,P,,rS.r.rPh.,Pv,rPrDoPP.P.Poro,eorrDforPPhfr.orfoeyfo,efooePrr..fsf,ef,DososfefePsrPesseesfPsfoosPsos.oreosesss,frhosomrssrsosroeoo.rofsosPrsoDroerofoororsrfeoslrrf.oooofooss,ofoPrfffosgfooffPePPooByrffaVsCooErrmEP.sinomomBBhoeononoodffegcrtomaaetoflomoheoccsllPEomoooemsPtttgilaeeglofmgdsyalooorrbyrtayi.niiglriPllt.oon.osyoeootyltlltg.gfar.rooP.yyyCnggPE..a.ytyratno..thPthpoooaslm.tlohogoogyllyoo..ggyy..! ASSOCIATE PROFESSORS BJJRJJLADFAWOFEAGFGFWEaaaaorrrededolleltuommmmeaaiivvfissnwowbilnlsrdnnttiillleejeereeeennafaaeaaakkgssssFdorrrlrrrmrredtddrriWddJPDCcLACCAdeWoiWHknaeWeFhasBiHuloHnumlfLeievaerriuldlrEaGaloilpiatirlneerallranisildGdnlhbirtdseearBenmmcaeolycwomewsHaeromnyiArBraAomCysyasagaHMHnfnlrrBdyurMeLbteHadCAGodolao,rraeuaSwRetfoermaMHlvyerinCJnoeamrlcltseeeo,rlslss,re,osk,lun,er,.bo,si,iann,,,tyseBP,nPJnirhPiB,,PnPr,dkrPnPh,h.P,P,hS.s.hhi,Pg.Ph.hSP,ho.hnBDD..PP.D,.h,.h.DhPD.n.gPDD,.DhhD....S..,Ah,e,MDDh..D,..A..,.,..r.DD,,.,s,,DPA..,ADA..ss,,AA,SA..AAhsAAo.,,ssMs.o,A.Ass.As,scsss,sDssAsAcsossoiAoss.sssAsooaiooScAocs.scosoassctsc,cicoiossc.sieotccassiia,iaiesocoicaaiicAaostatatoaaiceicPtteAiotetcataeetctaseiPeiercieetatasistaoePrePiaetPtosPPaoPtPefPetrrPoPecrteefrPorrorPPreocireroosooPofaPrfooPrirfssfPeffoefatforoerfsofePeereesesotrfoeesfofosssressroessefesssfssrsofosossefPoessssoeooooofesrPsrsoossrorsrerfrorssroosorrrsfsoosoroorroofoPosooooffroeorfPorfffofforfoeosffroEofPmossoffBBCoEPmCsofEnflCfoCofioaVoaOhnrtonhoflShoScrEnmhetoPcteelrooteemomeetonghgeCogmoommefemmgytreamoelfidPhodioyism.ointolCiosemsatoaogs.EliltrlImtIitohtblcoygroyrsnhnonroygeylg.tyygi.votlvgermsy.Coo.y..yyle!eyt.ogm.r..hsis.Cysgytteoitir.y.mrggoly.oaapi.gtts§siity.oor.ynn.ss.. MWEmoilirllriaeFmllreTTdheharoiycrepkre TVTaiastptculhemeyn,,bPMuhr.g.SD,.,.P, AhA.sDssso.o,cciAaiatsetesoPPcrioraoftefeesssPsoorrorfoeofsfsVoVereggoeeftatabEblnelteoCmCroorolpopsg.sy. . ASSISTANT PROFESSORS ERJDKKMAKRARSoiroauoaenlaeinheyvcibsbrguenxttlhmieefhdisdaranrrtDiJontteeHaGRdnlSidCMcCedeoeaooSltroosrnEarcbzstJnirydClCrckgaesithRNhomuecoaoyellynocanielBLSmodhtSisktLwruinWrtieea,ae,geaBernsniyamh,nPenukPg,,shkl,PbDhoeGa.PrM,.hn,DnPaaDih.k,luvhMD..Pm..,nSsiD,.PhsD.,e..e,A,S,..hAcr,D.P..A,,hsPAs,DhAs.tsPh,Ac,is..AisstD.,hsssADitsPitsn.asis.aADsss.,hnigtn,istsa.tss.attAiD,nstAaAsnaPittPnsA.tsnsas,rstrtssPnotsiaoPiiAsstrfPnssfrtPoeiettoatrssaaPsfrossntfesonnasreiPftossofoettnsrsetrsfrstoPaosPesPofnorsrosPorerrootsforofrsoforofosfePPferoPeoffsosresflrslPoosafssPaoofofoEnsonoreroPrmtnfmtsSrootosooPeooPmEofoflfemlaaornfoodBtCtgtEhgolhooPoyahyolnoImfcgo.le.nltlatyogoomoveBn.gymgrletiioiy.yssooog.tt.Pcllriyoohgya.ggeta.hymytio..oilsontgsry.y.. The New York State College of Agriculture C ORNELL UNIVERSITY, the Land-Grant institution for New York State, was chartered by the Legislature in 1865. By the terms of the Land-Grant Act of 1862, teaching in agriculture has been, from the begin­ ning, a regular part of the university program. In 1904 the Legislature of the State of New York established the College of Agriculture as a state insti­ tution under the title “The New York State College of Agriculture at Cornell University,” and made an appropriation for the erection of buildings for the College. In 1906 the Legislaturee passed an Administra­ tion Act defining the purpose and activities of the College of Agriculture thus: “The object of said college of agriculture shall be to improve the agricultural methods of the state; to develop the agricultural resources of the state in the production of crops of all kinds, in the rearing and breed­ ing of livestock, in the manufacture of dairy and other products, in deter­ mining better methods of handling and marketing such products, and in other ways; and to increase intelligence and elevate the standards of living in the rural districts. For the attainment of these objects the college is authorized to give instruction in the sciences, arts and practices relating thereto, in such courses and in such manner as shall best serve the inter­ ests of the state; to conduct extension work in disseminating agricultural knowledge thoughout the state by means of experiments and demonstra­ tions on farms and gardens, investigations of the economic and social status of agriculture, lectures, publication of bulletins and reports, and in such other ways as may be deemed advisable in the furtherance of the aforesaid objects; to make researches in the physical, chemical, biological and other problems of agriculture, the application of such investigations to the agriculture of New York, and the publication of the results thereof.” With the creation of the State University of New York in 1948, the College of Agriculture, as one of the four state-supported units at Cornell University, became an integral part of this new State University. “Cre­ ated to provide a comprehensive and adequate program of higher educa­ tion” the State University now includes more than thirty educational institutions. The College of Agriculture, functioning in this broad con­ text, offers teaching and research facilities to serve the agricultural needs of the State. THE COURSES AVAILABLE The resident instruction in the College of Agriculture is planned for those who desire training in agriculture and in the sciences most closely related to agriculture. It is organized, for the most part, in a course of four years, or eight terms, leading to the degree of Bachelor of Science. Those who want instruction in a special field may register for one or more terms as special students, provided they are qualified by education and experience to pursue the courses they want to take (see page 24). For those who cannot plan to take four years of college work, special curricula are organized, running through two years, to give specific train­ ing for definite vocational objectives. Transfer from the two-year to the four-year courses is possible under certain conditions which are described in the Announcement of two-year courses. A special one-year course in dairy industry has been established re­ cently. It is primarily for students who have already had experience in dairy work, either through family connections or as employees. Graduate work in the various fields of agriculture is under the juris­ diction of the Graduate School of Cornell University to which questions about admissions should be addressed. Aside from the above, there is regularly a six-week summer school designed especially for teachers, school principals, and superintendents. There are also one-week and two-week courses with specific purposes. Correspondence courses, without credit toward a degree, are available. The information contained in this Announcement applies specifically to the four-year course. Circulars describing the other courses referred to may be obtained on application to the Secretary of the College. THE FOUR-YEAR COURSE Of all the vocations, agriculture is the largest and one of the most important in the world. It encompasses not only farming but a wide range of related services that offer, and will continue to offer, challenging opportunities to young people of ability. Such young men and women, of proper background and ability, no matter whether their interests center in farming, in commercial enterprise, in science and experimentation, or in education, may find them all represented in agriculture. Farming, the basic occupation in the vast agricultural industry, attracts those who enjoy operating their own businesses, working with their own hands in the production of crops and animals, and managing capital and a small amount of labor. Services to farmers are many and varied. To visualize them as fields of vocational interest for young people, it may help to think of them as falling in three classifications. First are those of a commercial nature, in­ cluding the buying, selling, transportation, storage, processing, manufac­ ture, advertising, and financing that are necessary to make the products of the farms available for human use in a great variety of forms. Of similar type are the many enterprises that produce the machinery and other equipment, the feed, fertilizer, spray materials, and other supplies that the farmer uses in his business. Second, there are services of a devel­ opmental nature, meaning the experimental work of scientists to develop a better understanding of our soils, plants, animals, and the products that are derived from them, and of human relations. It is through the learning of new truths and their application to the affairs of agriculture that im­ provements are made. Agriculture, broadly interpreted, presents a chal­ lenge and an opportunity to the best scientific ability. And, finally, there are educational services. The teaching of vocational agriculture in our high schools, the dissemination of agricultural information through the various agencies of the Agricultural Extension Service, including the radio and the press, and the instruction of students at our agricultural in­ stitutes and colleges of agriculture are all services of an educational nature. They provide an unusual range of opportunities for those who are interested in educational work. The New York State College of Agriculture, in its program of instruc­ tion, recognizes the diversity of agriculture and the range of vocational and professional opportunities that have developed under the stimulus of scientific research. To meet this situation, the requirements for gradu­ ation from the College are extremely flexible as they apply to an individ­ ual student. The purpose is to permit each student to acquire a breadth of vision, combined with the necessary technical qualifications, that his objective requires. The College does not outline and publish a separate curriculum for each vocation, but within broad limits each student may work out, in cooperation with a competent faculty adviser, a program of courses that meets his individual, or personal, situation. The following description of employment opportunities that are open to graduates of the College includes those in which former graduates have engaged as well as some of the more recent fields of employment that have resulted from new developments in the agricultural industry or from within the College itself. They suggest some of the major types of instruction that are available at the College. A long list of specific occupations that graduates of the College have found available could be included, but that has not been done because experience shows that the objectives of students should not be too narrow, at least in the beginning. The intention is to point out some of the impor­ tant and broad fields of agriculture for which the College offers training and in which graduates have found satisfactory opportunities for employ­ ment. Many different types of training and employment that represent a range of interests and qualifications are described. They may extend from strictly commercial business in agriculture to the highly specialized sciences in which the opportunity for service and reward are the equal of any to be found. Government service, private business, large corporations, and cooperative enterprise all are represented. FARMING . . . A first responsibility of the College is to the young men who plan to enter farming. A good living at satisfying work and an opportunity to contribute to community life await the graduates with the necessary farm experience and enough capital to operate a desirable farm. These young men take a general course in agriculture, with em­ phasis on the type of farming they plan to follow. A general course like­ wise fills the needs of others who may enter related fields until they have enough capital to buy or rent a farm. The important types of farming in New York State are dairy, livestock, poultry, fruit, vegetable, and general, with a small number of farms concentrating on other prod­ ucts because of special interests or special markets. BUSINESS AND INDUSTRY . . . Business and industry are calling more and more upon competent young persons with agricultural training, especially those businesses that market farm products and purchase and handle farm supplies. The food industry is the most important agricultural business in New York State. It is made up of units of all sizes and types, from small, individually owned establishments to some of our largest corporations and cooperatives. Of the various foods that make up the industry, milk with its products is the largest both in dollars and in the number of persons employed. The College works closely with the dairy industry in its instructional and research programs. The perishable nature of milk makes it imperative that the latest scientific methods be used in its manu­ facture and distribution. This creates a demand for men with technical and scientific training both in the handling of milk and in the manufac­ ture and distribution of such milk products as ice cream, butter, dry milk, and cheese. Since many who start in the dairy industry will eventually have managerial or administrative duties, the training, in addition to the basic sciences and technical subjects in dairy industry, may include courses in marketing, accounting, economics, psychology, sociology, and personnel administration. Graduates are also sought in such related indus­ tries as poultry and egg marketing and meat packing. A committee of the New York State Canners and Freezers Association, Incorporated, has cooperated with the College in the establishment of a special program of instruction in the canning, preservation, freezing, and dehydration of fruits and vegetables. The Association will help to find summer employment for interested students as well as more permanent positions for them after graduation. Since the Association seeks young men who will eventually become managers, training is designed to pre­ pare students for plant, field, office, or sales work. The business of supplying feed for New York dairy cattle and poultry is of major importance. It requires men who know New York agriculture and, more particularly, who know feeds and the feed requirements of the various types of livestock. The production and the delivery of the right fertilizers, machinery, insecticides, and fungicides, and all other supplies used on our farms, require the services of qualified men. They may need to be well-trained scientists, technicians, salesmen, promotional specialists, or plant operators, or to serve eventually as managers or in other admin­ istrative capacities. All of these businesses and many others in agriculture require a knowl­ edge of financing, advertising, insurance, and other specialized services. Credit organizations, both private and governmental, advertising con­ cerns, and insurance companies have employed graduates of the College. Farm-loan representatives have been employed by local banks, insurance companies, and the various branches of the Farm Credit Administration. Farm experience and the ability to work with people are valuable assets as qualifications for employment, along with a general training in agricul­ ture, including agricultural economics. The production and sale of flowers and ornamental shrubs in New York is an important and large business. Many students who specialize in floriculture and ornamental horticulture are sons and daughters of persons in the greenhouse or nursery business. Others who do not have that background but combine practical experience with their training find satisfactory opportunities upon graduation. The College does not have a school of journalism, but it offers several courses in agricultural journalism, visual aids, and farm radio writing and broadcasting. Job opportunities include editorial and staff positions on newspapers, farm papers, and farm magazines. In radio, agricultural college graduates occupy positions as farm program directors and farm news writers for radio services in the state colleges throughout the Nation. HIGH SCHOOL TEACHING . . . There is continuing need for young men qualified to teach agriculture in the high schools of the State. Dur­ ing the ten-year period prior to World War II, there was a rapid increase in the number of high-school departments of agriculture in New York State, and one of each five graduates of the College became a teacher of vocational agriculture. With the advent of the war, both teachers and students in training entered the armed services. This forced many high schools to discontinue the teaching of agriculture. Others were compelled to employ, on a temporary basis, teachers who did not meet fully the certification requirements of the State Education Department. Young men who wish to enter this profession need an extensive background of practical farm experience. In college, they pursue a general course in agriculture including the technical and professional courses required for certification by the State Education Department. Miany good teachers of agriculture have gone on to better teaching positions in the agricultural institutes of the State and to good jobs elsewhere. The experiences gained through teaching have qualified a number of successful teachers of agri­ culture for important positions with business organizations. Graduates of the College of Agriculture also find positions as science teachers in high schools. To qualify for this work, students need courses in the physical and biological sciences and mathematics, in related courses in agriculture, and in professional courses in education required by the State Education Department. AGRICULTURAL RESEARCH AND HIGHER EDUCATION . . . Preparation for careers in agricultural research and higher education usually involves graduate study beyond the four-year course in agricul­ ture leading to the Degree of Bachelor of Science. Graduates of the Col­ lege of Agriculture with superior records and sound background in basic subject matter usually are accepted as graduate students in the institu­ tions of their choice. They frequently qualify for fellowships or assistantships which help to defray the costs of graduate study. Curricula which emphasize preparation for advanced study can be worked out with un­ dergraduate advisers. AGRICULTURAL EXTENSION SERVICE . . . The Extension Serv­ ices in 56 counties of the State offer a gratifying future to men who would like to work with farmers and young people in furthering agricul­ ture in the State. Each year agricultural graduates with adequate farm experience leave the College to become assistant county agricultural agents or 4-H club agents. WILDLIFE CONSERVATION . . . Opportunities in the conservation and management of fish and wildlife are found principally in public em­ ployment, with either the state or federal government. Occasionally, there are openings with museums and private foundations. The training in college emphasizes the biological sciences. The work is likely to consist chiefly of survey and research, but in recent years many management and administrative positions have been established. As such, the work is exacting but of great interest to those scientists with a desire to develop and conserve our wildlife resources and to help the people to understand them. The Department of Conservation at the College has printed ma­ terial on training and employment opportunities in this field. SOCIAL SERVICE . . . Another appeal for graduates of the College who have specialized in rural sociology is in the field of social service. The Department of Rural Sociology cooperates with the State Depart­ ment of Social Welfare as well as with other governmental agencies. The College does not prepare students for positions in social service which require professional or graduate training, but it does provide pre-profes­ sional instruction. Qualified graduates have received through the State Department of Social Welfare fellowships for training in rural child welfare. FOREIGN SERVICE . . . The international situation is such that the Federal Government provides opportunities in foreign service for qual­ ified graduates of the College of Agriculture. These may be in either the Office of Foreign Agricultural Relations in the Department of Agriculture or in the Department of State. As the program of the federal government to extend our technical knowledge to less-developed countries expands, the demand for agricultural college graduates, with the proper training in agricultural science and in historical backgrounds of the people of the countries where the program operates, will increase. Commercial con­ cerns in the business of importing or exporting agricultural products or supplies also employ graduates of the College. These opportunities, of course, are limited. STATE AND FEDERAL CIVIL SERVICE . . . Several agricultural agencies, both state and federal, employ their personnel from registers established by the New York State Department of Civil Service or the United States Civil Service Commission. Positions with these organiza­ tions may be of a research, extension, regulatory, or administrative nature. To gain a place on Civil Service registers, seniors or graduates take the appropriate examinations which are announced from time to time, some of them annually. DIRECTIONS REGARDING CORRESPONDENCE For admssion to the freshman class, to the two-year courses, or to ad­ vanced standing from other colleges and universities, all communications should be addressed to the Director of Admissions of Cornell University, Edmund Ezra Day Hall. For enrollment in correspondence courses, communications may be ad­ dressed to the Supervisor of Study Courses in the College of Agriculture, Roberts Hall. For admission to graduate work in agriculture and candidacy for ad­ vanced degrees, communications should be addressed to the Dean of the Graduate School, Edmund Ezra Day Hall. The General Information booklet, giving details concerning admission, expenses, scholarships, and related subjects, may be obtained by writing to Cornell University Official Publication, Edmund Ezra Day Hall. An­ nouncements of the other colleges, schools, and departments of the Uni­ versity may also be obtained by writing the Official Publication office. THE APPLICATION FOR ADMISSION Admission to the College is not simply a matter of presenting certain specified entrance units. For both the applicant and the College it is of the utmost concern that a proper choice of college work be made, and the College, therefore, in making its choice of students to be admitted, considers not only the school record submitted but also any other avail­ able indications of probable success in the course the student proposes to take. For this reason the applicant should give, in addition to his formal school credentials, the fullest information regarding his background and experience, the quality of his work, his resources for carrying on and his own purposes in seeking a college education, so that the College may have a better basis for consultation and decision. Correspondence regard­ ing these matters is solicited, and, if it is at all possible, applicants should come to the College for an interview. Prospective students who have neither lived on farms nor had con­ siderable practical experience in agriculture are urged to spend at least one year on a well-managed farm to familiarize themselves with common farm affairs and operation before entering College. This experience will count toward the requirement in practice which is described on pages 25 to 27. Every candidate for matriculation must submit to the Director of Admissions a satisfactory certificatte of vaccination against smallpox, not later than August 1 if he is to be admitted in September, or not later than January 1 if he is to be admitted in February. It is accepted as satisfactory only if it certifies that within the past five years a successful vaccination has been performed or three unsuccessful attempts at vaccin­ ation have been made. (For other health requirements, see the General Information booklet.) Candidates for admission to the four-year course must be at least six­ teen years of age. Students from other colleges or universities are required to furnish certificates of honorable dismissal from those institutions. The academic requirements may be satisfied by the presentation of New York State Regents credentials, or acceptable school certificates, or satisfactory ratings in the tests of the College Entrance Examination Board. Candi­ dates who have prepared for college in New York State should offer a report of State Regents Examinations in subjects which are offered for entrance credit and in which Regents Examinations are scheduled. Candidates for admission must file their applications and credentials at the office of the Director of Admissions, Edmund Ezra Day Hall. They should be filed during the fall term of the senior year in high school. Applications received after April 1 will probably be at a disadvantage and ordinarily will not be accepted after June 1. ENTRANCE REQUIREMENTS FOR THE FOUR-YEAR COURSE The subjects that may be offered for admission to the College of Ag­ riculture are named in the following list; the figures following each sub­ ject indicate the value in entrance units and show the maximum and the minimum amount of credit allowed in the subject. A unit represents five recitations a week for one year in a subject. In Drawing and Industrial Arts, 240 hours are required to earn one unit and 120 hours to earn one-half unit. FOREIGN LANGUAGES (modern and ancient) HGFItraeeelbrnimracenahw,n, ,ff1iifr,rissrt2stt,ttoot3otfhfooiurudrrtthhyeyyaereaar1r,112,,, 22,,33,, 3 44 LSGpareatiennki,s,hff,iirrfssittrstttoototfhofiuordrutrhytheyayer eaa1r ,r 121,,, 232,, 3, 3, 4 4 ,( I t i s d e s i r a b l e t o p r e s e n t a t l e a s t t w o y e a r s o f a f o r e i g n l a n g u a g e f o r e n t r a n c e credit a lth o u g h credit w ill be g ra n ted fo r a single year o f stu d y in n o t m o re than tw o languages.) MATHEMATICS AIEnldteevmramnenceetdadiraytAeAlgAlegblegrbaerab .r..a............................. 1 514 SPPollaalnnidee GGTreeioogmmoneeottrmryye.t.r....y..............................................................................................55144 SCIENCES BBCGioheotenlamoengryiaysltryS.....c....i..e......n......c......e..............................................................................................................5..4—1111 ZPPhhoyyossloiiccgsayl .G......e....o....g......r..a....p.....h.....y...............................................................................5i./42—_ l11 ( I f a u n it in B io lo g y is o ffe r e d , a h a lf- u n it in B o ta n y a n d a h a lf- u n it in Z o o lo g y m a y n o t also be c o u n te d .) SOCIAL STUDIES, including History (each course) ......................................... 54—1 VOCATIONAL SUBJECTS BADHoograomrwikcekiunelegtEupcrinoe..ng..o....m..........i...c......s..................................................................................................................... V1i1///222i—_--I61l AInndajyeucccshtetsirpgiathanlboslAtechrttoasoolrlte.h.a.s.edu...yb.U.j.e.n.c.ui.t.vs..ee.o.dr.r.s.i..ts.ay.u.n..b.d.-.. 54-1 54-2 For admission to the New York State College of Agriculture, an appli­ cant must have completed a secondary-school course and must offer either A or B, as follows: A. Sixteen units which must include English (4 units) and mathe­ matics (2 units). The remaining units must be selected from the above list. B. The New York State Vocational Diploma in Agriculture, with the proviso that two units in mathematics are included. A committee on admissions in the College of Agriculture reviews the credentials of each applicant and in making its decision considers the nature of the subjects offered for admission and the quality of the work done in those subjects, all available indications of ability for and inter­ est in the work of the course to be undertaken in the College, and the background, experience, character, and personality of the applicant. When it is considered advisable, the committee may require an applicant to take the Scholastic Aptitude Test of the College Entrance Examination Board. Prospective students who wish to major in one of the sciences or to become research workers should offer adequate training in foreign languages. ADMISSION WITH ADVANCED STANDING A student admitted to the College of Agriculture from another college in Cornell University, or from any other institution of collegiate rank, is regarded as having completed the number of terms and hours to which his records entitle him and receives all the privileges of students who have completed the same number of terms and hours by residence in the College. No more than fifteen semester hours of credit are allowed for one semester of work at another institution. To obtain the degree of Bachelor of Science, however, a student must have completed the pre­ scribed subjects in the four-year course and the requisite number of elec­ tive hours in agricultural subjects. He must also have been in residence in the College of Agriculture for his past two terms and have com­ pleted not less than fifteen hours a term, of which two-thirds, at least, must be subjects taught by the staff of the College of Agriculture. Be­ cause advanced-standing credit may reduce the number of summers available for farm work after admission, these applicants are ordinarily held to satisfy a part or all of the practice requirement at entrance, de­ pending upon the number of terms of residence for which they are held. Credit toward a degree for work done in a preparatory school on sub­ jects that may be offered for entrance to the University is given only to those students who, in addition to satisfying all entrance requirements, pass separate examinations in the subjects for which they seek college credit. These examinations cover substantially the same ground as the university courses in the subject. An applicant desiring a college-credit examination of this kind must apply to the Office of Admissions as early as possible, and in no case later than the day of registration, specifying which fifteen units he intends to offer in satisfaction of the entrance re­ quirements, and on what other entrance subjects he wishes to be exam­ ined for credit. If he fails to satisfy the entrance requirements in any one or more of the units on which he proposes to enter, but passes the credit examination in any other subject or subjects, he may use the latter toward satisfying entrance requirement, but in that case he cannot also receive college credit for such subject or subjects. A student who receives at entrance twelve or more hours of credit in addition to the requirements for admission may be regarded as having satisfied one term of residence. Under no circumstances is surplus en­ trance credit based on extra work done in preparatory school accepted as the equivalent of more than one term. REQUIREMENTS FOR ADMISSION OF SPECIAL STUDENTS Opportunity is provided for the admission of students whose needs may not be well met by the organized curricula of the College. Appli­ cants for admission to such special standing must present entrance cre­ dentials as other students do, and in addition they must present a de­ tailed statement of the program they desire to follow. They must show that they have had recent farm experience or other experience qualifying them for the special work they plan to do, and, unless they offer regular entrance, they must be twenty-one years of age. Students having a first degree and desiring further undergraduate work may be admitted as special students. The work of such students is ordi­ narily limited to courses in the College of Agriculture; for work taken outside, tuition is charged at the rate prevailing in the college where the work is done. REQUIREMENTS FOR THE DEGREE OF BACHELOR OF SCIENCE The requirements for the degree of Bachelor of Science are residence for eight terms, except for those who make an average of 75 or above, and, in addition to the prescribed work in Military Training and in Physical Training (outlined on page 97 and completely described in the Announcement of the Independent Divisions and Departments), the completion of 120 hours of required and elective work, as outlined on page 27. Freshmen are required to attend, during their first term, a course de­ signed to orient students in the life of the University and specifically to acquaint them with the scope and purpose of the courses of instruction in the College. The course meets once a week and carries one hour of credit. THE PRACTICE REQUIREMENT All men students must satisfy a practice requirement. The purpose is to make certain that they shall have learned some of the skills and prac­ tices in farming or other occupations for which they are preparing and shall have gained some understanding of the related economic and social conditions that prevail, particularly with respect to farming. Credit to­ ward meeting the requirement is measured in points which must be ob­ tained according to the following schedule: A minimum of twelve points required for registration in the sopho­ more year, all of which shall be earned from experience on a farm. A minimum of twenty-four points required for registration in the junior year. A minimum of forty points required for registration in the senior year. Credit is given for work done prior to college entrance and during vaca­ tions after matriculation. Many students satisfy the full requirement at entrance because of having lived and worked on a farm and others be­ cause of a combination of farm and other work experience that is accept­ able in their specialization. Prospective students who have not had considerable practical experi­ ence in farming or in their intended field of specialization are urged to take advantage of every opportunity to gain such experience before en­ trance to college, even to the extent of spending a full year between high school and college in that way. The experience furnishes a background for much of the college instruction. Practice credit after entrance may normally be expected at the rate of about one point a week for satisfac­ tory work. The amount of credit is based on the nature and variety of work done and what was learned from the experience. Since regular NROTC students are required to spend from six to eight weeks each summer on cruises or in aviation training, it is necessary for those who register in the College of Agriculture to satisfy a major part of the practice requirement at the time of admission. This should ordinarily amount to not less than 25 of the required 40 points of prac­ tice credit. Contract students should have no difficulty in finding time to satisfy the practice requirement and also take the required cruise. (See the Announcement of the Independent Divisions and Departments for information about NROTC.) Credit toward the practice requirement is given for work on a farm. In addition, students specializing in bacteriology, biochemistry, botany, dairy industry, entomology, floriculture and ornamental horticulture, food industry, nutrition, rural sociology, wildlife conservation, or zoology may be given credit for work in these fields, as follows: Students desiring to specialize in bacteriology, botany, dairy industry, food industry, nutrition, wildlife conservation, and zoology shall ob­ tain a minimum of one-third, and those specializing in biochemistry and rural sociology a minimum of two-thirds, of their practice credit for farm work. Upon their acceptance as specializing students and with the approval of the designated adviser for the specialization and of the Farm Practice Office, they may then complete the practice requirement by approved work in their field of specialization. The practice requirement for students specializing in floriculture and ornamental horticulture applies to both men and women. For these students, production work in greenhouses and nurseries may count toward satisfaction of the twelve points of credit required from farm work. The Department requires at least twenty points of credit from work in floriculture or ornamental horticulture. Students specializing in entomology must obtain the twelve points of credit from farm work required of all students for admission to the sophomore year; sixteen points from entomological practice. All students who are specializing in one of the fields listed and who expect to use work in their specialization to satisfy a part of the practice requirement must consult the adviser concerned with regard to course and other requirements for acceptance as specializing stu­ dents. Students are held for farm work to meet the practice require­ ment until the adviser for the specialized program officially notifies the Farm Practice Office and the Office of Resident Instruction of their acceptance as specializing students. After matriculation any additional farm experience that is required must precede the spe­ cialized experience. The practice requirement applies to male alien students just as it does to citizens of the United States, except that male aliens who matriculated before September, 1950, are held only for a requirement of twelve points of practice credit which must be obtained from farm work in this country. Those aliens who matriculated in September, 1950, and those who ma­ triculate subsequently must meet the regular practice schedule as de­ scribed for all male students. Prospective students and students who desire information about any aspect of the practice requirement or want assistance in finding employ­ ment on a farm should write or consult Professor S. R. Shapley, Farm Practice Office, Roberts Hall, Ithaca, New York. The Department con­ cerned assists in finding employment for the specialized practice. THE COURSES LEADING TO THE DEGREE OF BACHELOR OF SCIENCE (Required courses given in other colleges than Agriculture are described in the A n n o u n c e m e n t o f the C ollege of A rts a n d Sciences.) Freshman Orientation Course ............................................................. English, Introductory C ourse............................................................... Botany, Biology, or Zoology ................................................................. Chemistry or Physics ............................................................................ 1 6 6 6 Geology 115 (the requirement may be waived for students presenting geology or earth science for entrance; in such a case 3 hours are added to the minimum agricultural electives) ................................. 3 Basic sciences and social studies........................................................... 24 (Not less than 9 hours and not less than 2 subjects under A and not less than 9 hours and 2 of the 4 subjects under B) A. Biology, botany, zoology, entomology, bacteriology, physiol­ ogy, genetics, psychology, chemistry, physics, geology, phys­ ical geography, mathematics, meteorology, human growth and development, and biochemistry. B. (1) Economics, (2) government, (3) history, (4) rural soci­ ology, sociology and anthropology, and the interdepartmental course in social science, except that courses under these head­ ings in accounting and statistics may not be used. Elective in the College of Agriculture (including any courses listed in this Announcement on pages 37 to 97, with exceptions specif­ ically noted) ...................................................................................... 54 Elective (either in Agriculture or in any other college in the Univer­ sity) ................................................................................................... 20 Students who do not present chemistry for entrance are required to take chemistry. Students who do not present physics for entrance are required to take physics. All physically qualified undergraduate men who are American citizens must take military training during their first four terms. Enrollment in the basic course of Military Science and Tactics or Air Science and Tactics, or in the first two years of Naval Science, satisfies this require­ ment. Students transferring to Cornell from other institutions are exempt from part or all of the requirement, according to the number of terms of residence in college before transfer, and service in the armed forces in World War II also satisfies the military training obligation. Entering stu­ dents who have had ROTC training in secondary or military schools are requested to bring WD AGO Form 131—Student’s Record for presenta­ tion to the Military Department at the time of registration. (See also the Announcement of the Independent Divisions and Departments.) Credit either in the Basic Course in Military or Air Science and Tac­ tics (four terms), or in the first four terms of Naval Science, does not count toward the 120 hours required for graduation in the College of Agriculture. All undergraduates must pursue four terms of work, three hours a week, in Physical Training. Ordinarily, this requirement must be com­ pleted in the first two years of residence; postponement is to be allowed only by consent of the University Faculty Committee on Requirements for Graduation. Exemption from this requirement may be made by the Committee when it is recommended by the medical office, by the Department of Physical Education, or because of unusual conditions of age, residence, or outside responsibilities. An exemption recommended by the Department of Physical Education shall be given only to students who meet standards of physical condition established by the Department of Physical Education and approved by the Committee on Requirements for Graduation. Students who have been discharged from the armed services may be exempted. For students entering with advanced standing, the number of terms of Physical Training required is to be reduced by the number of terms which the student has satisfactorily completed (whether or not Physical Training was included in his program) in a college of recognized stand­ ing (see the Announcement of the Independent Divisions and Depart­ ments.) BACHELOR OF SCIENCE WITH DISTINCTION The degree of Bachelor of Science with distinction will be conferred upon those students who, in addition to having completed all the re­ quirements for the Bachelor of Science degree, shall have done all of their undergraduate work at Cornell University and have cumulative scholastic averages of 85 or above; and upon those transfer students who have been in residence for at least two years and have cumulative aver­ ages of 88 or above. REGISTRATION FOR COURSES The standard schedule for the freshman year must include the follow­ ing courses: Freshman Orientation Course ............................................................. 1 Military Training.................................................................................. 0 Physical T raining : ....................................................................... 0 English, Introductory C ourse............................................................... 6 Botany 1, Biology 1, or Zoology 103 and 1 0 4 ...................................... 6 Chemistry or Physics............................................................................. 6 Elective courses in the College of Agriculture.................................... 6 Elective courses in the basic sciences, in social studies, or in courses in the College of Agriculture............................................................ 3-6 In making his program, the student has the assistance of a faculty adviser, preferably from the field in which he expects to specialize. The adviser is ordinarily assigned to the new student for the first term, but following that he is chosen by the student. A student must register for at least twelve hours each term, and no new student may register for more than eighteen hours in addition to the regular work in Physical Training and Military Training. Failures in courses, either required or elective, taken outside the Col­ lege of Agriculture are counted against the allotment of the twenty free hours that may be taken in any college. If senior students who have met all requirements desire to take courses outside the College of Agriculture in addition to those required or al­ lowed free, they may do so upon paying for the additional hours at the rate of tuition prevailing in the colleges where the courses are taken. To be eligible for the degree, the student must maintain an average grade of at least 70 for the entire course. COURSES IN AGRICULTURE OPEN TO FRESHMEN Agricultural Economics 2 Agricultural Engineering, 1, 21, 31, 40 Agronomy 2 Animal Husbandry 1, 10, 50, 60, 70, 90 Bacteriology 3 Biology 1 Botany 1 Conservation 1, 2, 3,9 Drawing (mechanical) 1, 5 (freehand) 10, 11 Entomology 12, 42 Floriculture and Ornamental Hor- ticulture 1, 2, 5 Food Science and Technology 1 Meteorology 1 Orientation 1 Pomology 1 Poultry Husbandry 1, 30, 50 Vegetable Crops 1, 2 Combined Courses PROFESSIONAL AGRICULTURAL ENGINEERING A JOINT program between the Colleges of Agriculture and Engineering at Cornell University leads to the degree of Bachelor of Agricultural Engineering at the end of five years. Students in this program register in the College of Agriculture during the first four years but take courses in the Colleges of Engineering, Arts and Sciences, and Agriculture. In the fifth year the registration is in the College of Engineering which recom­ mends the candidates to the Trustees of the University for the degree. Applicants for admission must meet the academic entrance require­ ments of the College of Engineering. These include English (4 units), elementary and intermediate algebra (2 units), plane geometry (1 unit), and trigonometry (Vt unit). A foreign language (2 units) or history (2 units); advanced albegra (V2 unit) or solid geometry (V2 un it); and chemistry (1 unit) or physics (1 unit) must also be offered. It is strongly recommended that at least 3 of the elective units to make up the balance of 16 be in language or history. Applicants are also advised to offer ad­ vanced algebra rather than solid geometry, when a choice is possible. Each candidate for admission is required to take the Scholastic Apti­ tude Test of the College Entrance Examination Board and to request the Board to report the results to the Director of Admissions, Cornell University. Candidates are urged to take the tests in January of their senior year. Since it is the purpose of this curriculum to train engineers for agri­ culture in its many relationships of buildings, soil and water management, machinery, manufacturing and processing of agricultural products and supplies, drainage, irrigation, and so on, evidence of interest in and back­ ground for engineering work in agriculture is a qualification for admission that is given careful consideration. Only a limited number of students are admitted to the program, and agricultural experience and the quality of the academic preparation are important criteria in the selection of appli­ cants. The curriculum includes basic work in biology, mathematics, physics, and chemistry; a well-rounded selection of courses in engineering science and technology, including agricultural engineering; courses in soils, crops, farm management, and other subjects in agriculture; and general studies to provide a broad and useful training. Charges for tuition and fees, during the first four years in the curricu­ lum, are the same as outlined on page 33, except that students in this combined course are required to take more courses outside the College of Agriculture than are permitted to other students and for which they must pay, on a credit-hour basis, as soon as the regular allowance has been used up. The amount of the charge depends upon the specific courses that are taken but is approximately a total of $900 for residents of the State who are eligible for free tuition. The additional charge for the excess out-of-college instruction in the case of non-residents, who pay the regular tuition of $150 a term, is approximately $500. Payment for the excess hours begins in the fourth term, but the major part is paid in the third and fourth years. In the fifth year these students are subject to the tuition and fees charged in the College of Engineering, which at present are $350 for tuition and $60 for fees each term. A six-week summer session, between the fourth and fifth years, is spent in field study. Regular summer session tuition is charged. Students in the agricultural engineering curriculum must satisfy the practice requirement of the College of Agriculture by work on farms, as described on pages 25 and 27 of this Announcement. In applying for admission the applicant should indicate in the applica­ tion, which should be sent to the Director of Admissions, that he wants to enter the College of Agriculture for the joint program, with the Col­ lege of Engineering, in agricultural engineering. W ITH BUSINESS AND PUBLIC ADMINISTRATION Undergraduate students in the College of Agriculture, who are properly qualified, may enroll in their fourth year, in a joint program with the School of Business and Public Administration, leading to the regular Bachelor of Science degree from the College of Agriculture, at the end of that year, and to the Master of Business Administration or the Master of Public Administration, from the School of Business and Public Ad­ ministration, at the end of the fifth year. A careful selection of courses is necessary if the two degrees are to be earned in five years, so a student who is interested should plan his program with the help of the designated faculty adviser, beginning with the sophomore year. If the decision to enroll is not made until later, consultation with the adviser is necessary to determine whether the requirements for the two degrees can be met in five years or if a longer time is needed. The opportunity to receive these two degrees in five years, when the normal time is six years, is made possible by the inclusion in the fourthyear schedule of certain courses from the Department of Agricultural Economics that may be acceptable in lieu of certain first-year require­ ments by the School of Business and Public Administration. Similarly, the Faculty of Agriculture accepts up to nine hours of courses in Business and Public Administration in the fourth year toward the satisfaction of the requirement in the social studies. These substitutions are allowed only to those who have been accepted for admission by the School of Business and Public Administration and who have their schedules approved by the College of Agriculture faculty adviser for this program. In the fifth year the student registers only in the School of Business and Public Administration. The program of that year consists of certain core subjects that are taken by all students in Business or Public Admin­ istration and of concentrated study in a sector of the field of agricultural management. The specific courses to be taken depends upon the special interest of the student and the particular option that he chooses. Options that have been listed include: Management of farm cooperatives Agricultural credit administration Agricultural industries Agricultural marketing Public policy and the administration of government agricultural programs Management of natural resources During the first four years these students are subject to the tuition re­ quirements of the College of Agriculture and in the fifth year to those of the School of Business and Public Administration. For further details about this joint program reference should be made to the Announcement of the School of Business and Public Administration. W ITH THE SCHOOL OF NUTRITION A plan between the College of Agriculture and the School of Nutrition permits students of Agriculture, who qualify, to enroll in a combined cur­ riculum leading to the regular degree from the College of Agriculture, at the end of the fourth year, and the degree of Master of Nutritional Sci­ ence or Master of Food Science, at the end of the fifth year. To meet the requirements for the two degrees in five years, instead of the normal time of six years, the student in Agriculture should start planning his program with the adviser for students of nutrition not later than the end of the freshman year. During the first four years of this program, students are subject to the tuition requirements of the College of Agriculture and in the fifth year to those of the School of Nutrition. W ITH THE VETERINARY COLLEGE Students who do their preveterinary work in the College of Agricul­ ture and are accepted by the College of Veterinary Medicine at Cornell University sometimes qualify for degrees from both colleges. This takes about seven years and is ordinarily done by spending the first three years in Agriculture followed by four in Veterinary Medicine, including a com­ bined registration in Agriculture during one or two years. Payments to the University TUITION T UITION is free to undergraduate students pursuing full or special courses in the New York State College of Agriculture, who at the time of their matriculation are, and for at least twelve months prior thereto have been, bona fide residents of the State of New York. Since physical presence in the State, especially for persons under age, by no means constitutes legal residence, applicants who are at all doubt­ ful of their own right to exemption should address inquiries in advance to the Director of Resident Instruction in the College of Agriculture. No student is allowed to transfer from any free-tuition course to an­ other course in Cornell University, where tuition is charged, without first paying the difference in tuition for the credit transferred. Students in Agriculture who are not exempt under these provisions are required to pay tuition of $150 a term. Tuition-paying students trans­ ferring from the College of Agriculture to other colleges in the Univer­ sity must first make payment for the difference in tuition for the credit transferred. All students registered in the Summer Session, whether or not exempt in the other terms, pay a tuition fee of $115. New York State residents, who are receiving free tuition in the regular undergraduate year, may be awarded a $25 scholarship to apply on the Summer Session tuition. Senior students desiring to take, while registered in the College of Agriculture, courses in other colleges in the University, beyond those specifically required and also beyond the twenty hours allowed free, may do so upon payment of tuition for the additional hours at the rate of tuition in the college in which the work is taken. Tuition and other fees become due when the student registers. The University allows twenty days of grace after the last registration day of each term of the regular session. The last day of grace is printed on the registration card which the student is required to present at the Treas­ urer’s office. Any student, graduate or undergraduate, except as hereinafter pro­ vided, who fails to pay his tuition fees and other indebtedness within the time prescribed by the University is thereby dropped from the University. When in his judgment the circumstances in a particular case so warrant it, the Treasurer may allow an extension of time to complete payments. For such extension, the student is assessed a fee of $2. A reinstatement fee of $5 is assessed in the case of any student who is permitted to con­ tinue or return to classes after being dropped from the University for default in payments. For reasons satisfactory to the Treasurer and the Registrar, which must be presented in writing, the above assessment may be waived in any individual case. If the student withdraws, University fees are charged on the basis of 10 per cent for each week or fraction thereof in attendance. Any tuition or other fee may be changed by the Board of Trustees to take effect at any time without previous notice. FEES AND INSTRUCTIONAL EXPENSES A DEPOSIT of $30 must be made after the applicant has received notice of provisional acceptance. Of this deposit, $18 is used as a matriculation fee; $12 is used as a guaranty fund to be returned, less any indebtedness to the University, upon permanent withdrawal or graduation. A DEPOSIT OF $30 is required for a uniform, payable at registration in the first term, in the Basic Course in Military Science and Tactics. Most of this deposit is returned as earned uniform allowance upon comple­ tion of the Basic Course. A UNIVERSITY AND COLLEGE COMPOSITE FEE of $62.50 is required of every student at the beginning of each term. This fee covers the following services: (1) Health services and medical care. These services are centered in the University Clinic or out-patient department and in the Cornell Infirmary or hospital. Students are entitled to unlim­ ited visits at the Clinic; laboratory and X-ray examinations indicated for diagnosis and treatment; hospitalization in the Infirmary with med­ ical care for a maximum of fourteen days each term and emergency surgi­ cal care. The cost for these services is included in the College and Uni­ versity general fee. For further details, including charges for special serv­ ices, see the General Information booklet. (2) Willard Straight Hall membership. Willard Straight Hall is the student union; each student shares in the common privileges afforded by the operation of Willard Straight Hall, subject to regulations approved by the Board of Managers of the Hall. (3) Laboratory services for courses taken in the State Col­ leges. (4) University administration and endowed college laboratory services. (5) Physical recreation. Each male student is entitled to the use of the gymnasium and the university playgrounds, and to the use of a locker, bathing facilities, and towels in the gymnasium, Barton Hall, or the Schoellkopf Memorial Building; and each woman student to the use of the women’s gymnasium, recreation rooms, and playgrounds, and to the use of a locker. (6) Student activities. The fee helps to provide funds for worthy student organizations as approved by the Board of Trustees on recommendation of the Student Council. A GRADUATION FEE of $10 is required at least ten days before the degree is to be conferred. BOOKS, instruments, and instructional supplies may cost from $25 to $50 a term. MISCELLANEOUS RULES AND ASSESSMENTS Every student is held personally responsible for any injury done by him to any of the University’s property. Assessments, charged to the student’s account and payable at the Treasurer’s office, are levied upon the student in certain circumstances, under the following rules of the University: (1) A matriculated student desiring to register after the close of registration day must first pay a fee of $5. (2) A student desiring to take an examination or other test for the completion of a course in which the grade “absent” or “incomplete” was reported must first pay a fee of $2 for each examination or other test. (3) A student desiring to make an appointment for the required medical examination or conference after twenty days from the last reg­ istration day of the term must pay a fee of $2. For reasons satisfactory to the proper authority, any of the abovementioned assessments may be waived in any individual case if the student’s failure to comply with the regulation was due to ill health or to any other reason beyond his control. Application for such a waiver should be made to the Secretary of the College, or, in the case of the medical examination, to the Director of the Student Health Service. LIVING ACCOMMODATIONS FOR M EN. . . Approximately 1500 spaces are available in the men’s Residential Halls. These rooms are in both temporary and permanent dormitories, and accommodate one, two, or three persons. All rooms are completely furnished, including bedding and bed linen. The range of prices in the temporary units is from $182 to $240 a year; in the per­ manent units, from $248 to $355 a year. Application for assignment to space in the men’s Residential Halls should be addressed to the Director of Residential Halls, Edmund Ezra Day Hall, Cornell University, Ithaca, New York. No dining rooms are operated in the men’s Residential Halls, but meals are obtainable at any of the cafeterias or dining rooms on the campus, or in the restaurants and cafeterias within the city. From $12 to $16 a week is the minimum allowance recommended for meals, and some students spend more than that. Off-campus housing may be obtained in private homes and rooming houses. While most of these are on East Hill and adjacent to the campus, some are downtown. Prices of off-campus accommodations range, in general, from $6 to $8 weekly for single rooms, and from $10 to $14 weekly for double rooms. The number of privately owned homes that offer both room and board is few, and the majority of students living in them utilize the same eating places as outlined for use of men living in Residential Halls. The University anticipates the publication about August 1 of a list of off-campus residences that have been inspected and approved. Approval is based on good sanitary arrangements, adequate fire protection, and both satisfactory furniture and living conditions. If a student rents a room not on this list, he should make sure, through personal inspection, that these requirements are satisfactory. Students planning to live off-campus are advised to come to Ithaca prior to registration to complete room arrangements. Students are usually requested to sign contracts for the full college year, and the details of such agreements should be clearly understood at the outset. Inquiries on off-campus housing should be addressed to the OffCampus Housing Office, Department of Residential Halls, Edmund Ezra Day Hall, Cornell University, Ithaca, New York. FOR WOMEN. . . All undergraduate women students, with the excep­ tion of those who live at home, are required under university policy to live in university residences. These residences consist of dormitories (Resi­ dential Halls for Women) and sororities. Exceptional circumstances that seem to make living outside these buildings necessary should be re­ ferred to the Dean of Women, Edmund Ezra Day Hall, Cornell Univer­ sity, Ithaca, New York. The residence charge in the dormitories is $447.50 a term, or $895 a year, and the contract between the student and Residential Halls Office includes board, an allowance of personal laundry, and rent of furnished room with heat and light. Room applications for residence in University dormitories are not con­ sidered unless filed on an official room application blank. Such blanks are enclosed by the Office of Admissions in their letters notifying candidates of acceptance to the University. Requests for information on dormitories should be addressed to the Director of Residential Halls, Edmund Ezra Day Hall, Cornell University, Ithaca, New York. The Dean of Women has jurisdiction over all women students in the University, and the prospective students are requested to write to her for information concerning matters in which they may need assistance. Departments of Instruction W ITH OUTLINES OF COURSES THAT MAY BE CHOSEN BY REGULAR OR SPECIAL STUDENTS AS AGRICULTURAL ELECTIVES St1hp9ee5c3iC-a5ol4l.lneogteic eo.f UAnglreiscsulotuthree.rwCisoeurnsoestede,ncallolsecdourinsesbraarcekegtisvewn ililn ntohte bbeuilgdiivnegns ionf C ourses n u m b e r e d fro m 1 to 9 9 are o p en to u n d e rg ra d u a te s gen era lly ; courses n u m b e re d fro m 100 to 199 are in ten d ed p rim a rily fo r upperclassm en a n d grad­ uates; courses n u m b e re d fro m 2 0 0 u p are in te n d e d prim arily for graduates. ORIENTATION Ag1r.icultuOreR. I EONneT AhTouI Or Na .wFeeakll, tteormbe. Carrreadnigt eodn. eRhoooumrs. Rtoeqbueiraendnooufnacleldf.reshmen in AGRICULTURAL ECONOMICS FARM MANAGEMENT gfrioa4fdsoeartfef5egeurdft.Aames1idteolihc0ieifnsLsntnm2fsn.igisa.gntcft.euObsrginsFoed,ownt.nmyraApFeicartrTyRhttoo42oeahffMd--lraiit6l6ytshtn-s.h.:die,dnMceaPWosypfriAcfouoozraaorrerNotfrrsgnremdreiAatsoeupuisninfnGnsocniuahdtzrgbEion1oeao,uW0Mudutrsnig1psliodanE.rlfnoaaierpNvOfndsbrreasnTuoenec,niafh.rnndioptcdat.egphr;laSeofsoyp-ctfpsisdharcetaeiaeurednwnrmydaedgohoetditrnfeorargtntiebennspeacyr,innsfmmooatireTazfar.adsrmarlsptsetC,hisr.mWoiertsfnLaaaeearnkdfesrTeaayemc,irtnhntvmupdaifrabstsioeovriumfsrttpersen,ovaiodenFinmsMhsresaositsitghh2bsutWeehl-irfep4msaea.l;rnaemoFaapbnNffrlosyoort1oiatsrrnhi0otnainste.ftgg,ooeornWsrcpafmfpeyoaedeaacuenvucrrptnri-rioaseefbteettriwsryneocss,­ mtfsdasheiliedytsaeepC1ssek,iror0siosesrn3ctsca.gotKtoin-huafaFdeetrfcispiAaoacneoorcnoRairclunn1gMo.n0tdcasu2itneian.tniColeztgLfsraO;amtemimnScoiadtaTnenunntardhaotoeAiogfspoCdte,enhasmCrW;ceaceOatmoinnunUFutdsegenNta8htpnsT.soor;dtodIfLaNmcstraeeceGbemdoostoseu.hfertaronaerFcdttcasooasshc,slr.claytoosa,ftuaneaFlnrdrlpemtoscp2c.osl-ait4rfeutCdo.iddoirrnWynetgidf;onaiilgirtisnfrnuaefgtfrmonhamrrrmimesnm1e.a6car0otTihi.bmzoohuaAnueest;-irisontsscam.enooxscuesPiaetrarrhssnteeeoedtrduefcPrsqroaonrunmonosi,f­­­­ fSPdarniarofedAt1mfure0edrro4qdveet.uanahaiyntcAeshcriDrteneerdsVgie,tgisuAochsodtonNtuue.usrCdncrysAteoE,esfpD.oips1fNSr0o$Feo2th1xw.mAe5iFmeR.YoMat2rort-geir4pkaM,sntiSrASzaatraNna8etst-iAeo1pt,G0noa.krEwteaWaMinntti,hdaEorlnNreopeapaTnvere.ixtrni1apcSg6teuip0nolF.rsanierrnPidgorrfoafeoytffermeersrmmaetsrjnoo.iopcrrrn-Ces-i,-rtn-yte-got-pdo-ei-at-ls-anb.tndoehdfr,recfeeaomtrulmhlareonrcskuitneeristgdn,. hpaPnrorooud[Ib1mrfl0segep,5somo.svaorsceFt.rcraAnindmcReeenMntostfaL.la]fAnapNdBrrmoOoigtnRrlsaag.umbirvoFaserann,olclneeifn,tfpeehrr1cmoot9ud.5osu3ifCcn-t5gfria4ev, r.dimmtiyt three hours. Prerequisite, course 102. igoorfragfnaatnrimlzaabtlioaobrn,o,rs;ofaccriomaln-slsiaedbceourrarittimyo,nanaoanfgdewmoatgehneestr,, C r2e0d7it. twoMhEouTrHs. OODpSen OonF lyRtEo SgEraAdRuCatHe sItuNdeFntAs.R TMh M4-6A.NWA GarEreMn E1N60T.. PrFoaflelsstoerrm. W st uaAdryrdeisspnce.ucsisailonp roofb lreemsesa rscuhg gpersotbe dle mbys minefmabrmersmoafntahgee mgreonut.p.O p p o rtu n ity is given to PRICES ARerAtlsatttiaeonnndtsi.oSnciiesndciersecatnedd tEoncgoinuerseersinign amnadthienmathtiecsSacnhdoosltaotfistIicnsduinstrtihael CanodllegLeasboorf gra1d1u5a. teP RsItuCdEeSn.ts.SpLreinctgurteesr,mT. CTrhedi9t. tLhraebeorhaotourrys,. WOpe2n-4.toWjuanrrioenrs,4s5e.niPorrosf,esasnodr A studyP e a r s o n . of the factors affecting the prices of farm products. BUSINESS MANAGEMENT otrfaAtEitontnegninitnieoenrthiniesg,dSicirnheoceotcelodnooftomHitcohsteeilncoAuthdrsemesiCnioinsllteraagdteimooninf. iAstrratstivaendenSgciineenecreisnganind tihneaCdmolilneigse­ iWntA1e21rp11c..roemWFtapItaNrierorAhneeNnnoCsf2iIv4fAie5nL.asnuLScraviTabeAlyoTrsaotEatfotMebrmyaE,seNincMTtsaS.co.croFuTanllti2nt-eg4r.mpWr.inCacrrirepedlneits 2tf0ho1rlel.oewDheoodcutrobsyr. Lectures, M Fani talzygseisr anda l d . tiauncrt[Feki1osoe2nre2asp.pnienadArngsCodoanCncesdcOeowlrUauihbvnNooitnsrTwgaIotiNofsfrhiGcynoatoponMpecureiEainrolTaddtHeisvrtaOasettswDaenmae.dneekdSnt.]hptoserN;tihnroaegetnrcaogtbleriyurdvsmsseiisnn.aensiConsdferesp1cd;or9iosr5tetc3scet-hod5arr4uned.rdeiensbhguocdubogurmsse.mitnsT.oesnwslyotrualsneecsd­­ M th eW1Wi2r 6hs.a1pt0Fe.ccAiWoaRol apMprerrEreoanRbtilvSe4e’m5s.CsaDOroiefsO,couPwrsEgshiaRaontnAisztT,haIteWiVyoEnoh,Sra.fvTienFhaatnrl2cli-ee4dt,.e arWtmnod.adrCroceo,rnneatdnr1iod4tl5.t.whPhreraertohftehoseusyrosr.hHaLveeecd tures, lduo nn ed ;. wgWtaohxtaC1oiar2aort7bieeno.lnxsenipBd;2ieUenc3rast2Sant.rtItdiuNooLmnEioemeStninhsSigttesaegr,gdiLveopAewtrnoWianncce.uthbripsciuFpehasaefililprlnylceplastartnsooes,dsbrlmmlieenlge.emcaanlslsuC..idnprMiegrnodrgboi.tlfecTmptohrrnsroeteprmoeaefacrthntpsyo.a,;urtlrwiisec.inullslLs,a;ermceitsonutratrteetgersaesgs;Mteisnt,ohWaepnreidtrFasnoncn9ees.­ FhesiqoAduu[Ae2Rirrv2saM.sa6ttl.iuEeOondRnRptysESeo.n’Sof fPECstrAooroOemfRseOgeeCsraPsaHfordEucrunhRadHMAtpaeeTmrEdoITseblVtunHluEentdamOSdel s.n.D]ptsFSirnNoabwlolAtlhtheNomtiesgDrsihmvfaieoe.vnfPledGRc,ionihOvroaeeBpd1vneL9ire5Eaciwn3toMi-uv5aroeS4slfs.te.estIrhnNe1a2t6elTiteHyarenaEadtrusr.2Fe4C,I0EraeLondDrdit thtOweiFor con­ PUBLIC ADMINISTRATION AND FINANCE eraAl ttPeunbtiliocn Fisindainrceec)tedintothteheCcoolluergsees oifn AGrotsvearnndmeSnctieanncdes.to Economics 502 (Fed­ psnrposetPthhuthfofearuferorororGi1deafctubsn3eioeliofullce0ondervcfin.mhcmrtpihesceeiobartTe,ysgluiendtdzsoHirsmewmeosiettrnnE.ubnrexhvaigydniippyTccoaetRsaehsfpgn.bnsUTirotednNcosvhReiatbdeteiudrtilimAwrhzesde9necme.LepomnunmrYrsWssoUte.CsosecvnianartuoeICt,khnrinTrdrtadotoe,eaaIva,nandnZnienadlnfdeEndoudb1SdtdNrche4t,hhtahed5totihth.aehsAewooolimesTfsfNwppohDprogar(tnoehlotforoshal2etrvetHcseit-retuo4aiiascInorrlnn.tnSo,fi,icocmuWtisiyottnirGth.tnessi,aazeentctOtrsAeolaterunVcen,issdseiinhdsEst,eaxuioizsnRar2ntuaoevhmd0Nlttonredee1giryMnlfn.aaieebwdennlaEoPdeeiasafzeriNdaytnonmerrssafTcddtreeetwlil.oi)rsvutnvw,ostidFooinphacerrawTgisero:ltposhhltwLeiaemwuituncrttorefoghhrtsocratozradmoernevp.tatmnsph.erywcssooreeetCngreutrartmhrrvcnrsdfsaeeoitseecmemdsbnnetrtioyasss­tt.t gacanatriaucAo1dse3ne,u8.ssa.tb;uAtuedThsmyiiAsnsotteXounosfdgArsie,tcThntaahIetlnseO.dpcNtrhLoipa.nepenccirFgcitspuseaolsrlneleesasoxtl,veaarmeiMnnmrdicn.otWiepmmCdraereFecadttriiaenic1xte1atsst.htohiePuoroerfnlcega.penrsouhtwbooSlutfichrcsire.efonivOfnceeappnneuu2cnbee3l;,3itc.owanPeijtduxrhonpfpieeeornmsorsdsppoi,hterusrarteKsyeniss,eioniorandsnnh,rdetiaacrniixkttds­­. hctrioaauA2tlir3otsr6te.ne.f,nePPtrfrieiioRnmnnaOcaneBircsiitLlaoygEliNvfMaoedernSwmgtiIorYnNaiodsartuPkrnaa,UutteiimBonncLsblt,IeuuCraddneiondAnfgtDsap.sdrMtomTabIteilNne4im-Ias6Snts.rdTaWiRtnliovAaceprTaruleIobOnrplgilNcaa1nn.5ain6zdFi.amnatPgiliolr,noniptfs.eeetrrsrmasstoo.irnoCnnLe,rulewdtaiizdtt.hmt hree isnpies­­ btronfS3ieiur6oopnlA0d2tanraoi.3tgnrnnni7eeocageP.qtinneanrusoodxArtghieyrfarDeiremfppmmsmidMssunio.onbaabrrIannaleCeiNmtcacLfiregcooIoeu,oeSrnadneumtrTigigrnztotsReic.aefcnftlkAsewutui,edTldnioxteniuigIinrnOsrhatggtateloihoNl,nruiv-ogsrpaserstrggrc.OagoneoatogFnmePunvr,criraeszeiymmnePaar.nttnrUasimedo;arlBinnaelaytLdlnioootIscapCffntalouuslrahdbogAiyllrgpieegcGrvsnoaaecRafndli(dseifuIszsemCoaa,domttiUfeeinmoeriLagnsasltpTotn,rurvaafUodsoegtbtieRrreaolnnmteAntmeams,eLd.aensmanrtFentioP.ndofdRi2fCse-laOts4ooedpi.cGrrumeaiarrnWRbslsig)neloA,eainsMraan1tbrrnnee3Sualdnd0.t,­ M A R K E T IN G kLmiCtaniceseragctiT*ecinnont4dhsaguug3uiig;rtns.peetspsfmsicyMon,ltosyaugetMuItenrerLomtsrfhKeeWpsaoca;hngounaMwidrrFvdsdsaeeA.syssf9dResF.efoidnoKomtfDeosrrrEaaitasrnmroTclumednucIidelisrNtuklf-eiskooycigGo-nreedudnaelmi,mriAaasnttliMNaisreloiktrtrDbhukns;u.2deespt-;etBi4iernoni.cUbtncgsouiWSnnbsciIoigunaonNmsrseimrEtsdniescseSai;nlsiSkarsloays2.rfbpM0gSoeo1marucAr.nbtadNsirPnjzieeAurfaolcfoatffGteiafstorimecEeonistnninuMsltcskora;ilErunnumNssdgdeeaeTslr:la;f.kiinnnfetdgyaStaicppn.natmercognsiirnadnsraoggknfaa;edfdtmtefivaerntamenchgrrtde..­­­ ren14405.. MDiAscRuKssEioTnI, TN G W. SoprriTngh t2e-r4m. .WCarrerdeint t2h4r5e.e Phroouferss .soLr ec D tur ar e r s, ah M . F 11. War­ * C ourse 43 w ill n o t be given unless a t least te n stu d en ts have been accepted for th e one-year curriculum in dairy m anufacturing an d m arketing b y Ju n e 1, 1953. monaeCrkhaealtlri-andcgatyecrihasantindcnsefilvose;f ahtnhadlef-sddeaeryvmicafeinesdldanftordirpcsoasnttods vinsiusvipotplvflayerdmoisfn afmnardamrkmepatirrnkoged.tuiCnctgosu;argsaeelnteicnrincelsau.tdivees hou1r4s2.. LMecAtuRreKsE, WT I FN G9. FLRaUboIrTatSorAy,N WD oVr FE G 2E-T4.A WB LaErrSe.n F2a4l5l. tPerromf e. s sCorreRd it a s thr mu ee s­ httsteareaarbnAnmnlde.sislpsni;tonaurlgdrt;aepygtricoioooobfnsnlteatshaml enosdaf;encamdcosapnarerosrkceimeatesristcionosnfgfeaar;lrvcetittoccyaeropissleme;sirpn-paveorntoofidldtvi-muoeccndoae;nrkisnleuaatrmwitenhaegesra-ndmodoerfamgrmakadnneeiitdtzshit.anortgiidbosunotfsoi;offnrsuc;airlteesmsdieatmtnhrdeoatdthvisnoedggoses;f­; Cre1d43it. tPhRreIeC IhNouGrs.A NLeDctuDreIsS TaRndI B dUisTcuI OssNion,O FM WM A FR K 9E. T WMarIrLenK . 24S5p.rinPgrofteesrsmor. wfSadsrtaoaoennupicalHctddeIetshcneonooortrcomfncewsnsaofaensarnlaturdmtrcosnhmk.eoupdeeedobmrertipesrmictpnse;eoi;ctisrgnailaopokmglwtensniaocviaisgpsdiiyeoeadfldssuaolnfelltnercryiiomemislnsfeid;ftziseulomde;kinddrdni;iiseh;lfrtsknfodeprttetiwseurhsbrpiptdeenueormnecrittnmntcmihiaindptieaajsniglolnresgtkrpsiwoi;rnernefhgitaofgctcioneunrhetddirgahnnpelneposrslpgdaaacyrpeianlasatdsroittcoeriatyotmipinbopncnedyirenrfoospoqdsdcplrruuetooiueacvasffncrteltelaeseuripl;uttyrieyrdsmroic,;eacfledmgnaiarpnpasudsinsrgrillriiiadkafccyitim;sgieeinoorsdmfiiga;lnatckhlarpluhmeroooroltkrbictofswceuajeetfrmtdioasaecpne;rctidlrgilatvokboplteedtsouororsepussos,ri;rcwvnlipticaaieinotcreonnshgoressnddkes;­.. esuLamnelAd1ecps4ethum4radrg.saeerintMazasaedihndAlueidapRdit,neKdcsiiElntssuutctTudeduderIysrNesetinogohGtfnieso,tnwEdhTaeGehlmoGTmcahSohnaamdrvkA1pefe1Neot.htirDinatWpigdooPnauocr,OoflrteuraUpnyrnsoLdeau2Tnl41etRd5r4fy.Yf0ie.c.gOaigPenpFnsrde,oacnylfpleersgtiistocngeoesrr.gmmrDreS.aalaprdakeCrtuiceroariteaftniiendhscghi.ts.itptoutspwd,iecomns tahstrookauenrbtssde., atwgro1i4c6hu.oltuuDrrsAa. I l IRnbYtuesniOndeeRsdsG. AeLsNpeeIccZtiuAarlTelyI OafnoNdr AsdtNuisdDceunsMtssioAnmN,aAjFoGrEin2Mg-4E.inN WTd.aariSrreypnriinng2d4u5tse.trrmyP.raoCnfedrsesdoiinrt SrmcineipedcaMeSnenunocnasamyctgtjreoeeyadrmr.ne.odevdfneivtlttooihsppeirmoreonldebesnucletctosumefrseactsnhoodesaftsrtdemriaeniignlrkiydhvsaedinnniedndalbiulneytsrgrtsar,lyeda;epadnrteocrdrcahsedacsenisonnioneapglsdses,irofaafcaetniniarvddeteinosdtmn;isswbatarrrakaiybnnesudctithntionetghsgeinooircrfgrefatuahnsneiezcmatdiitoliaekonfi.nrfsiy;;­ smaooYpgffoereE1ridntnnk4hcatc7g,oeii.lrneNiyvsotmMra,emipciwptAwraiecotdRiYindtoheKuoftneocurEdktanas.T4ncr,ne0tIioe.NoesgtmnFpGgseesp,xn8hIct.appNesioeWeniSrusdfTlaNotroIr$reryTmn5ew,0UneftdYThri2uneIo4iiObrt5rasky.N,dpCdPvShirei.vytotgiyasfoeSiernctiispanoasrbsluotilponsreoegsBctp,rttertyailenriunprvagmesnetspiska.notnog.rCodctafkrpets,siadptoutaeitndntecydritatniwonlsmiogz. aeenthdFahodto.euumrfTmrsra.ooardmtrkEaakelynetNsritconieonlgowslgf­t rtwe noO24b2h06jo.e0uc.IrtNisPv. TreoEsRfneOorsofsDollmrUmaBeCrnkrTuteIntlOiiknmNg. iterTde sOetoa MseAniRorKs EaTn rch; organ dI NgGradRuEa ization o tSeE fr sAtuRdCenHt.s. esearch FWall4-t6erpm.m. .CWredarit­ agencies; selecting datineosdnigponlfsa;nrenmpineotgrhtosp;drosajneedcntgsai;nppeperliercilnaimtgi;oinncaarosyef irnsevtsueudslittesig.sa; tifoienldpraoncdedoufrfeicse; ssuurpveeryvsi;sieoxnp; eprirmepeanrtaal­ mitaiVnontEgarg2Dcj,Gf4oiiopts2srEyrruci.onTucptgghsCAeersrraUBiiammonmsLnRii:ssnEaRsoagtSiafhElor.sneinNccdauFuetTnorlcaprtdolueorlPnenrlcoiagRttcomleiiOusmrebtinmsceBua;tsr.rjsL.oyicoEnLrCofesMenpsrhgcsesriStru,opduambpiprdtIleioieenNsnmrmtg,wgoWsp;poTlrooipeHngFifahnyeEcotrt,1khuse1i;earnnM.sncgt.WfdreAiaesaIaRn;lvnndrseKtrdmpgeeoEonenafptrdrTratfg1eeabrIi4pdutNlni5eaios.tGc;enckPas;raarpnooOnggedpfdciosFeniv.vsagteselCh;FolgryenroeRfmatnRaUflcsioebiakulInrlesileTttt.miSsemmitsunu,aassAdtrrsberkNkeouneenDtcttths.­­­ TaPefimtrAneo[AdpB2fieh4snLsast5gEusts.suodiS,sdrRe.ynaERontFsnSaodafEslmlcmpArrrateuiRaetsjiscroeCcmstraaiHiecrl.ncneghCa.]inIrnipNaeNnlrdypooisablttiTaglsntegHrwmniiocvEoifuneinlghntrouMeiruprnetaArrhssleeeR.1sa9ebKrGmn5ucE3tishaavi-Trnte5kipenI4vesrN.esotii,jGnnergcpeatossloeOmt.eafForrnclforhaugFteiytpR,sryUoeaajaInenTrcddstS.s vOeApgNeetnDabtloe VgcErraGodpEus­­. ,veagpeptalbiclaetsi,onwitohf DC 246. oAnIsRulYt S E M IN A R PinRstOruDcUtoCr ON T fSo.r SppeErrimnCgiOsstNieorOnmM.toICC rreedgPiitsRtOetwrB.oL WhE oMu4rSs-.6. IGNiWveanMr reiAnnR aK2lt1Ee3rT,nIaNPterGofyeesaOsrosFr. S d p e vSe enellcoepec etred.d. pMroebthleomdss aarned struedsuieltds, oanf dprpelvainosusforresseoalvrcinhg othnemthetsheropurgohbleremssearacrhe arree­ viewed. AGRICULTURAL POLICY hrmspFAeioreomenouAd1nnbro5est1sl1:snrer.6a,.egm0lOvfa.PositnfpehArUadweaersusnBmsssntioLooostdfocItippaleCiir-tanrcjochtgutsoegernPndPradiaseRrdoimeowcsruOrfocsvsiaeu,ntBatshsoesstsLsimuoeeoaEgrnsdnigtgiMcRuoreapidrSosccrsretheu,obenalgidaOttnfrrsunaaa,FsorrdcmoemrtTensgAwerh..ripnGsahratd2iiiRccccu-the4IseaC;dtaseoUufrfdoepsLuratpuTlrgoiigdkrUnrieretgcasRnluy,dtEslrutl.et.uaaocnrtLeeedFcenacatsalttlstlueldunrefdaeuotcenserran,redmtic,Tseno,.sdcllurTWeaeCschrdtretriiey2tv9da-.eai4natDr.anarlcdiaytWsthnzcirotgeuahendesree­­..­ hou25rs0.. OpePnR OtoB gLrEaMduSateI NstuRdEenStOs.ULReCctEureAs,L ML O WC A FT I O12N.. WFaarllrenter1m6.0.CAresdsiisttatnhtree ssPptrueoAdcfiieefsirssceovarriseeRswoaopuboprciflneiestdhoa lenlto.ocparaitngiocrniicpulpelrtsoubroelef, mapsnr. odd uthcetioanp pelcicoanboimliticys,o fe mi nppiruitc-aolu tipnuptu td- oa ut at p utot Comrre2Aent5dht2iedt.aisctecwtquioousSnsivhiE.oaoMnlSuerpnIosNetf..cAicOaMuRlpreraIe2ntNn-t4ett.noPatWUiggorrBnaiacrLdruiIueslCntautgerPi1avR6lse0tnOpu. rdBoAteoLbnslEstetsiemMsctwsahSnhnttoOihqaPFuhtreaoAsvifneGevosoRsfholaIvardCenRUacclooyoLubzlTlriiensUncegstsRiovpE1neu5..b1oSlripacgnriodpnvoge2lir5tcne0y­rm. proposals. AGRICULTURAL GEOGRAPHY AND LAND ECONOMICS fre2s.hmenA. GLRecItCurUesL, MT U WR A LF G9 EoOr G1R1.A WP HarYr.enFa4l5l. tDerimsc.usCsiroend:it ufnoduerrghroaudrusa. teOpsetun- to npdSPraertoaontHutdfteiesrus,,sactslotWtoshrar.iencTa-d-Ulh--tn-poo-ie-rt-ere-sFc-dpo. e2nSc-ott4maivtoieecrs,oWenna nvopdirrroeTonstehmhneet7r-n-d9tca; oypcu.rmnaogtp.r;riieagcsnur;daldtiunluirtvaeeet;resrteaosgdtcuikjoudnsepatnrmlotsdet,runaFctdti4oeo-fn6i.naigWnraigNacrrueirlcwetuunlrYte3uo4rrta5kol. wsNftoriorEtu1thc6csot0otosu.pnprdeoF.eenmcOLniittaeOcoslcDtaiseuntsmrupEedeptsChechentOaastsnNsiSdoscOfinhdoMfoinostoIhcolCuedths,oSseCf.iionoNeSnclcl,pleuourgMtndirenoiitngmoiWgofitcneApsrFmragoonr8.dfid.cuCduScriiltaneetivudot.aritntehg, eetehdxr1iCsec4otee5rlpi.lhbet oPugbuetryiorosfonpe.fse,DsrHaomenrosidismDgsnieecoeoGndEnrscoeauofsfmnptfoehp.cmetiiaiocilnnlsy,.­ eftethWc2auafcoo-kfcro4uauPe1nten;rrorch8nssrsotr1y;ee,.psm.ssnortsiPiifihcyAmcn2r1aesiviGtl4namecoal5rsmRoalnlia.tavlbnidrsIytneDiocCulddoeryti1faUpsifo0oicttvnfor2Lesunoa;crsaTrrylgosslaitUirhnajnropauaoobadnRedrnmudi-rrluAilpiaiiaoidtaotocnLniyrtdolgsed;piln,ecariaLmysslenssayltcAdefebusfenrNanotdoodeicnrtoermmDelsmadnrastsstuaoo,ss1rtprr,EieoiyafootvfiCnT,oacnnicdsaO.ppe5ctlhr2idoNaT:goiy-3mnmwrn4Os0tda.;iahpo.McdreapauuWiAonIfllasayirCyesteatitlsee;lrSeafdostrorn.hpcensrdiitrnotssaroufSiutbpdecopcn1lleslfoer6adaPnimun0senacrtrs.dsrorhgssig.effeaWerio.nuFcasttfsgaasedhoLeoektrcueriemreoonaacinnunnt.Cnt.eu;nsfdoeirldCeaesfnrelfuvtnsdrkrua,enadgrdldtdmrTtieiaiuroanntiidmsnpnt.eTus;sget;,ahhnattarTerntherae8sdheeel­,. patwn.mdoC2.8oth0hnW.oesuiaSdrfrsEoer.reoMandOtIi opsN3une5Apn0pRo. lofyPn.IbrloNyaSfspeitcseoAscoGipgfrrirRcoaDbIdtCleoueGpmaUitrcseLsa TsUtuRdeAnLts. GREeOgiGs fovffa.rcyomfropmaraytievaer tRraAtiPonH Yb.y taogryiecaurl.tur Spperrminigs e and sitoenrm. .WC7re:3d of populatio i0t n FPare2llr8e1oq.ruiSssPpitreEi,nCgcI AoteuLrrmseP. RC1O8r1eBdLiatEnModnSepeoIrrmN imsAsoiroGenRhIooCfuUrst.hL eTOUpineRsnAtruLonctloyLrA.toNADgsrsaoEdcuCiaatOteeN POstruModfIeeCsnstSos.r. iwCnootSernkrpekestlcthiianatolt. wtihsoerskustioutandbelanent.yfoTsrhumebjiesmtcutedoiengnrtathpnehorfmrieealpdlrloyodfiuslcaetnixodpneeccateondndotmodiispctsrreibpthuaatriteonias. roefppoartrtoicnulhaisr pgTPrrrUeaoA2cdf8Reeu2csdAa.sretoLietIrioNcsrLCatTulAaoRdcNndceOikDonscDlmtsui.UpEnssaC.CCinooOyTnuNIrtoshOOefissNMrec1Iso8TCeu1aOrSrsa.cenh.MdSSipEn2r90iTn-a71Hgg2arO.intcedODurmlnSateut. lOoCeraFrsmetdRotihrtEerSetfheEireeAhldeoRutChrrisoHpusor,fsI.SsNtOa9t-piA6se.tGincARssoIssnCohlcyoUiuaLlttdoe­ ral land economics. FARM FINANCE AND FARM APPRAISAL gstrua1dd8ee4n.otsfF 8aAn0RdoMrtobFethtItoNesrAe. NLuCencEdteu. rrgeSrspa, rdTiunagTtehtesr1tm0u.d. eDnCitsrsceudwsishtiootnhh,raeTvee2h-po4a.usrsWse.da rOcroepnuerns1e4t5o1.0 g P2 rroawfdeiutshasotear H w heAidclhsutusneddryv. eo ft hseomu n. d financial arrangements for farmers and the credit institutions ostfu18d80e7n.otsrF baAenRtdt eMrto. LAuePncdPteuRrrgAer,IaSTdAuL1a0t. e. FLsataulbldoertnaetrtsomrw.y,hCoTr eh1da-iv5te. tWpharaesrsereedhnocu1o0rus1r..s ePOr1po0ef2ens swotoirt hg W aragdruaadtee arren . praActisctuediyn otfhefacatpoprsragisoavleornfinfagrmthse opfrivcaerioofusfatrympse,s.methods of farm valuation, and DEPARTMENTAL SEMINAR AND RESEARCH opthferr1wem9eo5isr.hskoiUoudnNrosnoDefd.EeaApRepGnsroRtdufiAendsgeDsnoUutrpAdwoeTnhsEiortihnwRegEillpStorEsourAbpelRegeriCmvstiHesuer. nitFdnhaeetlrhltwaisakonerckdno.usaOrpsnrepdienmngthutetsoetremsoxebstnte.ianoiCrtnsraetwnhddeiitthwqougnriaretaltiedttnyoe acvaerTrryhageoesucotouifrnsd8e0eipsoerdnedhseiingghtneesrdt.udtoiesafofofrdsuoitpabploertpurnoibtylemfosr uonudtsetarnadpinpgropurnidaetergsruapdeuravtiessiotno. stu2d9e9n.tsS EtaMkiInNgA eRit.hFeralla amndajsoprrionrg mteirnmosr. iMn t4h.eWDaerpreanrtm40e1n.t.ReDqeupiarertdmoefngtarladsutaaftfe. AGRICULTURAL ENGINEERING FTmiinnheg2A1tc,-.e1h4hr0Fac:mo3,noAis0sifucaRt.rsoalsAMlfleatgtmnehprMdreielmcastEehuen,l.ColnetSduevHItsdtraoaAtcocalkNtonroEisvdIn,neCggrgfaSsiaipv2nr. sep1meul8Feict:arawhrinlanlsicifgrpneaoirnsirLrinmgnagasgbnpaeodnrtiqeirndnarutmgtoimoup,rntmdoiedReetreosevmin.rcresst.elP,toaarCp3rosne0rfdfee0parisdb.uinsgiimgLolteiraptrtyatbhJsht,oerieteoronweanntfa,toahihtnreraoiymrngnu,kdsrssMya.aaaspntniLeprTddmelficaasctWts,onausstprii.rsTeoletusnaah:mnsotoobTsnr.f­ wtdeoleorevA1ymci0,tc.erceWinoscH.uasOlrTtFsuheUaodpreSiopnnErtltthiesHaFi.nnsOdNc2eetL-ords4aDt,:i3tnowo0ipMna.edgtEnAee,vCrgteeoHrslxioucAfeppurrNepclastilIushybCermisalSailetn.aynEdr.FetnoaLpgllegilutncihmvoetiuerenbrnrkesiinnpsoa,ggrnni,TnLdgfaaaTrubuteethocaorresmmao1tt.2noor.berCiiiCpnelreasaesi.tldre,dsiPrwt,msreoetashwlfnleroidesn1fseg0oom0rhnm.oeWcuLashorcrasamhbi.ngioeniFhcreoaoatsr­fl,. the simpler machines of the home. LAeg2cr1tiuc. rueSlstUu, rRMaVl WEEYngI1Ni0n.GeSe.troiSncpgkriinRngges1te2ea0rrm.chR. eCLcraietbadotiirtoanttho,rrFeye, 1hT0o.ouwLrsae.br oPRrraeotroaedrqy,u,iasMnitdeT, fTioerlridg.WonAo2sms-4ies:tt3ar0yn..t ProAfessstuordyL eovf inthee. use and care of levels, transits, and plane tables, w.ith .spe.cial emphasis on their application to farm problems. me3d1i.atFe AARlgMebSraT RanUdC PThUysRicEs.S .LeFcatlulretes,rmM. so tu rrAaGl crroaeuqyrusaeirneidmn Aetnhstessi,setaliennmstuePlnar ottaiforeyns,sopvrroeLbnelteivlmai ntsi eoon. f, CWreFdi faanrmd t 8 .thSrteoeckhionugrs2. 1P8.reAresqsuoicsiiattees, PIrnotfeesr­­ fbuunicldtiionngasl; areqstuuidreymoefntbsasfiocr sftraurmc­ animals. OpEpadrrninpefi3Adgnfve2eicni.norticeepeuoFosnelsutentrAlirsylinsynRtgyegttMoptaoodekRffseeaeasScnrsoigomgTefrnncaiR-ccorcebcrUuoduuehlnritCtslestuedLot,TrriaaunvU3tlbcgie1soRtaeiirtcconEaasohngntSont,idonrssyaoteLrDsn.emuoArdrcTemianBtoiwsegooOowfinmonsRe.ftgtreuAhItdehRtTw1ee.oOinopnartfLrRcsdkaala.rYcuwbmotd.AoinhecrsobsaaFstulthiapoasielltarrrldaayepnigc,pnttetclegiWniucrPscmeraarrroolte.ai2fnnolwe-nts4Codtlsshy:erro3ekesr_0otidagfc.iLiknnatebAimnavtaoghgpsinnrinuecdieosecmru.dltahloeihtyxosuaioiusrnvgeaurngee.lt of farm buildings for efficiency of operation. fissOnitttrugptAuidencjenogtcnib,oottssuoncrocpsaaloedelnmlrddamsesntresudoeicdngptseilnaoyhneinertdfs.eo.wttAuoLomngredaekrcictctaoqiuuslnurlweteatu,mihonreTraptklhfitanah1Esrg0enim,.zges.fLitdonuTa.redgbheeiorennirgnatc,gtowowrrLiryeteah,lcdbtMiotnhurgeasT,teocrrooooifmeprsehm.wTaonhPondrrok1wf,t-eo5oaso.osnlodsLdrwiowmoFnroioktonesidensdw-.gf,tionctioos3noh0l­­ rneeqe4ur1ii.nsigtTeE,LAcaobCuoHrrsaIetNo4rGi0e.sF.LAePcRrtouMfreessMs,oErMCFHoWsAsN.9.I CLSa.boSraptroinryg, tWerm2.-4C:3re0d.itAtghrrieceulhtuoruarls.EPngrei­­ mtriapAnaigscoetuatrkhseeengdeetonsiegvrnaiselidtshstocophopaornledpsahtrooeptset.haechpfraorsmpecmtievcehatneiaccsheinr tthoe lhayighoustc,hoeoqlu. ipA, faienldd oisMttferA4udmT2ce.ttciootooaWrunltsrTwEs;aeheLnsnpDgd8toyiI-vt1Nriesn0wGtpg:ue3a.dli0fdreuF,.innnaotgdlsrlaaMamonresdnoesctrapatrriTlcoisnngw2a. n-eM4tdled:r3rimp.n0rg.;aC,cilCtwnoircieusetdphgirohtisfnp.ogoencxteieyaralhmcoee,umtygrpl.ievhnOeaensniswealeosllaondbiFfonagrra2mt-ao4-nrs:dyh3 0p. eLriiomd­, ocputctionng­ otwr 4ot3wh.ooAulrDasbVaoArtaeNtroCmrEi.eDsP,reFGreEq2Nu-4iEs:i3Rte0A,,LcaonFudrAseRosnM4e0StoaHnObdeP4.2arFraaanlndlgoeprder.smpPriirsnosgifoenstesoormrf .iFnCostsrresudcaittonrod.nOeMnore.r hmCalecCnoktoussnagwoshtf,r.utshcheteioecntirmcauneltdaarlrsemapwaac,irhbiajnonebsds, saaanrwed, ujwoseeinlddteitnro,g pteelqaacunhieprm,thweenotoo.pdearantdiomn,etcaalrela, thane,d garidnjduesrt­, fovjsuoenarnalT1erif0tochnah1hretres..mLcfELsaoaa,neLrubdcmwrEotsusrieCstatreheetTndoasieRed,royam.rIMl,sCsp.ThIwPaWoTsirwYtiehsre1erOo1qth.nRNueiLostThaiaatdebHep.,opEsrlPceaicolrtFeooaucAftrrteiysioRseo,snMnoM1ro.afaTnF2ndeau-dll4reli:cnnP3ttseehr0trirya.cmsl.ilitA.acystCgiofrr1oinec0rdu3oillttifagutnherhadltre,leceh1Etr0ehni4acogatui,olnrresae.enqtrdhOuienipppgemeonqwReuneteiort­­ ecTTiSonahrrgAs1TeeWi.0nph2aeasP.ntsroru1dedFr1dar.snyoeATodqRpRnohueitMfcirhsaea2ietttnhii-Pe3or4de,0On:f03,capAW.0orrpmsi.uOEonsrwicRnsAsaieete.ppgarlpnrrFe1ietltscariccoaulPilaonrtlrattfstoiutmPeoifrorhoneaimpyssnsless.s.oiirpEocParCesnntrirr,igMoine1oipndcn0idoili3epwtaleaaniretaleihdrwnnrredgree.maeeedqkp1Luj,hh0uaioa4trbsosue,toimmrsrosba.eereotnnonOttatrhsirpfe,eoraesafran.nmenigqndtAeuottdsreievsaj.rcoucanoLctnlanoeiialaonrobtsmtreco,.soiricmLaPnatercnfbooacldurufctyseudtt,sosriiesernoMonssng.r,­ sLcMatupinaarraAdb1etace0soyhs,3risienaP.ntTnutgreoiFodosraTfyIryensEhi,s.dnLosMoPfD1drer1ueta.hTrSscMeetShhiqnAteWuougopCcis,sfakeHiofr,itenterIdhr,gcNtseTaicolEr2ihoenzm1Ru,i8nrYa2.saogj-.enop4,Odre:S1an3rnpage0Aodrtr.riiosrnosceAuPgnircpsho,gitsyttpare,aasinrctinltimctuoodislla.nPltdau1raCigopr0dnaef3regjele,rusidassoEasnitordetnmderegtdeahiiM1innnrn0wceetig4leeleu,,orledifhoikhneeor,agdfrura.tt.vrohrLseme.asbbtOeeiofnqiprageuaerl,itdnrvoaparnmtilroeegosnaec.jctdeu.hs.AnsiLniisoneesgrcoss.­,­ cphheoaru2inr0osi3dc..,sOW1p1e5An21-G,o4nR:13l1Iy05C.2toU,SaLstoenTcndUkioi1nRrs1gA5a3L4n,1d0oM.gr rPAtahrdCoeufiHerastIeseNoqrsuEtiuTRvdaYeelrennrtDstys.E.. PSLrIeeGrceNtuq.rueissF,itaeTl,l DTtreharwm8i..nCgCoarmnedpdiutMtintegh­ree msaanafdMecthyeid,tnhyeaoisnnd.adsmAeoniccfaolnysftootrirmeccsaeislcs.aafnnaSacdlutyoiesrtmasis.bpiialrintiycdalomftraecmahtaimnteeerniadtlesos,figvpneolwaopcepirtliieersedqauntoidretmaycpecniectlase,lraatliugobrnirsci,cualstttuiaortnaicl, NoiCmuorL[eptt2pdla0eguib4mtitov., terehantEnrrttaeoXsicernPtyaihEvn1aoed9Rnu5Idre3msMf-.ff5aiEoRc4erhl.Ntedi,gnTiteaAsesntsLrdtasutniosAodtfanGebprRibolywviItaCyeprryUecirpnLmhlgaaTirnsUasctcisoRotnenaAdrniiLosdttfiiocttnErshas.Nec Gi nI sNt rEuEc tRo Ir .N GPr.ofeSspsorirn g T e term. r r y .] toPoforwso.epDrererateteiqroumni.rienmCatoeiomnntpsroeofhfepnofsawirvmeer reports are required. OaA2spn-sp4rd2Asie:o2n3nnc1Fk0i.llao.aeutndreiAdlvysPagSyMnrtrsOooictcefeeIecumsdLshelsstnauocAinrorfoiaNorculGsrsrDsraEse2anun3Wydpig3n.piA1gnl,eTertmhaeoEderreRiunntdagthateMeelsRiAgesierntNqrusuieAdgiaaevaGnrnatcdiEtlhoseM.nncLt,oP.EanrdNLbesitroveTreercu.qartcuusttSoiiriosreopniysnrt,,ien,dTogTicftocotThwetuierhrlemsesre,9. d.Ra2Crn1Loard,iaaendAbdaf,oiaggtrrreaamotnthnosdroyrepymseoft,eiynemhTdlods1shu..,, rs. voanll2ey3n1tt..o LFseeAcnRtiuoMrress,SanTTdRTUghrCa1dT0uU.aSRtetEocsStkuiDdnegEnSt1sI2.G0.PNLr.earSbepqourriainstogitreyt,e, rMTme.2cC-h4ar:ne3di0ci.st At1hs1rs5eo3eciahotoreutrPhsr.eofOeeqspsueoinr­ pGrriSnactyriu.pcletus roafl sdaensiitgantiopnr,invceinptlielastiofonr, hfaeramtingb,uailnddingres.friCgehraartaiocnteraisreticisncloufdemd.aterials, sfltaiopgtrrS2taie5npttrih1geoe.ccntiaeaSwsbrlPemoy,wEr.ktotChhCrapIkerAtreoidLandpedioptaPesnaqeoRryudntOam,ebtBreaeoanLnrnfdtEacmcMhopiolreiSortreoifmeIfashiNsgsoscpruiaiAeorcncsnGu.iablRttlPeuoIrrieoCnarrbelteUetgqeariLenuisnstigTesetiriUdnt.te.eoR,ePArratiohnLdfegeeqsEsosutNonuarGdtpeeFIrnorNatbeb,ElinelEpicmtrRyhosIvNauiadnnnGedddd.e,trsrFatiaianinflnflvi.tenhosger­ nee2Pr5rie2ns.ge.SntEParMtoiofIenNssaAonRrd.FdrFiesaclnlucsashnio.dnsopfrirnegsetaerrcmhs.anRdeqsupierceidal opfrogbraledmuastein satugdreicnutslt.uMral 4e:n3g0i.­ spr2in53g. teSrPmEs.C CI AreLditT OonPeI ChoSur.I NOpAenG RonIlCy UtoL TseUniRorAs.L TE 1N2G. SI NtoEckEiRngI N1G20. . FParollfesasnodr FtiersPe rnfeocsrehnp. toastiitoionnsanodf sdeisrvciucsesioinn tohfe tvhaerioopupsofriteuldnsitioefs,AqguraicliuflitcuartaiolnEs,ngainndeerreinspgo. nsibili­ AGRONOMY SOIL SCIENCE f9tstrtiiheaa.vomleieAn1anC.stpiehia,nloxoclegdntaouowsmomrsTsfobeio.pHnilefslrlPaoeEtsafrih1ioleeroe0iNrrrfnnl0atesoissA.nq,lr.iiguvTtLwyueiAeUasi.sdtibteh.tRceotoiG,ErhpnuaeCarrtAasotrhheftdrNiieeyurcmsD,duatleitalMseaalbPtarlroiRbsyTnrtroaOugerW1tfdoaP0eewtr2rEonyeirt.nRtoTsyhcrTPheaprI1utoEeoht0dforer6SeiiotstFisadOhcnonoegFr2dem-afBtS4upGhcrO:onhi3eassdIo0disLaclt.ytoimoSuo.gCu.ndeyr,aensFlnet1dapat1lwrlal5osre.pohpelrraleLilernesl4txcpci9epfitr.puusien,lrrcTenegtsewsias,dtnoheodMrftmoramep.WctplaaCiaiitknnnarFette­­ d it equ6i.vSalOenI Lt.S P. riSmparirnilgy tfeorrmf.reCshremdeitn tihnretehehotwuros-.yeParrerceoquurisseit.e,FoBuior-cyheeamr issttruyde2ntosr aidts­ womofriiatAtmhttoeardcpiyona,uotrartnMsiilcenyuiTnldwageWriatslhrioenifplTgeefrhreewmrnoitcitirshleistFiyttoohn2eatn-oh4cdfe:o3miop0nfrp.satocrcCsoutianictcilttodraoonwlrl,.leuilpLsnlergeo2cop0stfueo1rir.llteiimseMe,sreo,rT,.saifoHneTnrdit.hillpti9zbl.eaornCslt,da.rladenlwdateilool 100. Lab­ tnhserofmseoainlss, scah1usoo0rnL0u1vss.r0eoeis1sycoL.t.tinaunPobSgrraefo.OessrriaeInwtLdqtoeeueraraiypCstl,hirLteeeMwtrA,aiSttpcohiSoeorruInsmTFrosoIiielt2Cfs-;1fAs4oo:tTori3immlrI0-Osa.e6utNriCtoovoarenlAy,dbtNhwedceDleaaaltreslarsqS;ai1ufnU4iifcg3vieaR.ealtdldiVFeo.niEnwetP,l.Yodro.raLkfwneeSdcoscpstrouorkgnirrneseriogseCs,gptlsrltTaaienocprefmehTsy.ph..trhaC1Lec0rta.ielbcadCoebirtaoailrntdatohwtrsorieoeerliyesll vchMPPoaorrtoneAu1iFfrsor0eesen2ssq.8r..tsvuu.oPaTiSdCrsrtyhOiiiaotmZeelInodw,aLflwraemcitteolrhtyeAluemelarrNsfsa1puoeDpn0rrrsoo0e. crs.a1tedWiLstoovosanAreabsnlT6ooacoErnfeaafddRttn.hosdoeruOyinCl2c,ndodOeFeouerNrrpga2slSlre-1ela4E-1tddci:oR3ouaonny0aVrstAeaipoSdsnTeraedrtIrmaSusOnmri8ddtNshes-a.ti1egyho0rnoaa:fSd3pidpoesp0ulfrl.diaointctfChegtaresatioilpmodiit.lnenwinrsameotonrlrflu.dscs1towiC4oni3larr..etaaedgAnLrirdtesocscnoowttoucnhamirsrateeeteyserer.,­' sPoriePl1r0hec3yqo.suniicdOsaiitRltieoGa,nncAidnoNguc.rIshCeOemnS1.eiOcLaIaeLlllcS-ptdu.raorFeypsae,SlrltTaiteteusTrrmhdoaf.9y.CorfCrgieeaadllnddiitwctrtewislpolo.il3sh1o.uusAressd.soGfcoiiravteecnrPoiprnofpaerlsotseodrruncaDttieaownyseaoanrnsd.. fodPSagatrlyyeEl[o1,rcnte0feoaiqe4erlnu..oml]ddigsF;NyirttOareeooitl,tpRtafetgEcniftoioohdSvunrraTeeronnssutectoSgieOnsh1soiIosiL1tliashlu9Sne5rda.dg3enAe-FvdB5ddea4oillpa.roltorlapitntnnhmedycoreamiupnc3g.lkt1eh.sCarnnerOodogefcditochifrntaoyesrqdtiiewsorusonitomrl-aoeslohagdidoy.lfe.uiCemrlAspod.arnnnisGotaruirginilpvteftseoomi.nnrmersAinetnargtsul,sicsaitisttlhntrotaracerentlrieuntfo-odanPritonerfdrogoefyrfetbeoasaitiusohlrorssle-r..­ nsoptms9nooi.enritranaieaT1ilrcgW,er-t0ih-tmshl5ibcyesace.ocayyreounafsrsSuoetnrpafessOarnsgpfemerioelmsIsaismrtL1acds16naovoe.c0tdfAnafrio.oontN(mrpnceLs1Dveya6)aodpasnbftlrafaeCuooiungmteardhRndelatsduedimOtocoe2uptnPetrrrnirygniooidp,rontMnrsaefcuWdriA1tipnruonc1oNldao,etsoetAsamsetoryrtusGirmosdostTfEeaypnpomhnseensMooc,drsimipfEl2fmaegiti-Nserhrs4racmdasaaT:inite3dtoi.ufnnc0unarmcog.aFerenmt,oaaefCdfliaaflninaretmcttmildrohtaodteineisinnwrnlc,dmosireziiarontle.issinlpnsorodstCiinrl,Np1nusr4r(e.peclo3A2idwrtmA.doo)igutrderYPp.co,futrertonhcLooiwaroortfbnkeiemenvlc.desfeityistmtEueoyo.hslrmr.sduoePcsuppi—Lor,tnrphermsaoairT.-pbpesrp-si-tolqPlsi-aTerun-rnt-taiighioe-s­­­­. wt2ahn0ie1dAt1h.0iot6nsPhu.tsreuttoSrdftubOyehciseotIsoocLolfhrra.ebtMBmhLoreriIecoaCcamtatoRludarrOfybjeuoesBnmr,ncItatgOMi.yroLonbuOsWepGsotfaY8ok..tfehCnesFoaafisllloodlriwml tteiepwclrolrmoop3o.uh1rloga.CutairLrnoesiand’sb.mictorsre,atdhttoirhtereyew, ihtFhout2rhs-e4. :p3Te0hr.me Cislaselicdotwnureeolsfl soil organic fraction, ccfoioaru1tre0sa7edP.vr1oPafnoHecrsYespdoSerIrCumRnA.idsLDseir.ogEnMraDodiAflulPatehtHeresO. inLasOntrdGucYgt.orar.dFuaLaleltcettuemrremisn,.oMrCs reWinditFAtg8hr.roeCneoamlhdyow.uerlsPl.r1eP4re3rqi.muAiassrisitoley­, proTdhuectipornin. ciples of soil physics, with reference to soil management and crop roemq2Cmu0hi1ese.inmtdeSi,ecOdca.oIl LuMcrosCemWHp1oEFasMni9tdi.IoSCnQTauaRldanYwldi,teaplLtlirEvo1eCp4e3TAr.tUniPeaRrsloyEfsoSeifss..ssoSoAriplsPrc.ioenuDegrcisstheec.ruimsns.ipoChnyresoidfciatcl tchhreeemihsotruyrsi.s Prerec­­ hemical processes in the soil, including the behavior of different plant-nutrient elements. rtshoturl2Lledm0eee2cen.htntuotCruwelrHisismt,.EhilPMtaedrbdieIfoCrfreteoaAqrteuLotniwrstyieMtcneeh,tExyecTemorsHctuiucirOsadseleeDsn,tS1tesac.anhOndTndFiqdTQuehSeumsOa2olIf-inoL4tsar:tt3riAsa0vttNu.eiodACnaynLasinldYdgdwSQeIsseoSuilgila.lnsn2.etS9di4tpa.rttioinPvgreofafAetmesnrismlaoilary.rsiPizCsee.reeEctdhhniet­. S9itSsh.Oatei2TtcIuC0sLhfr3,aaedS.clda.dtceyowoFTvruesfaeHirlllelslooEledfp1temd4str3eormeGia.ipnll.EsstP,f,NCrowooarErfimnneetSeddhsaIsiStotoui(,for1stnhew)CrMheaoltehinfiOcnedhhtRehop.itPeurshirHenosGic.pOrirtpeGLieolafeiOtfnvseaeGcSlnotoYsfaii,lnncodlGnaaAsrflstootNhieurfeDripcnwsasahtotioieioCclf,nhyLtaeahAanaseSrdfsaeS.wpeI(Lop3Forl)eIiflcdeCt$td.uhA3rTetTeoiwssIc,OsohcoMaoNilarlslal,elWc-cdt(Ote2aeFrF)dy­ from each student attending. ttieor2nm0s.,4.CanIrdeS dOliatTbOtowrPoaItoChroyuTrwEs.oCrPHkr.eNrEeI nqQruUoislElimteS e, nIptNerlmiAmiGsitseRiodInCtooUftLeinTnsUtsrtRuucEdteonAr.tNs.LDeAcsBtsuIirsOeta,LndOteGPmrYoo.fnesFstsraoallr­ B rAa nppd lti.cation of isotopic techniques to agriculture and biology. hou2r0s5.. PSrOerIeLquiFsiEteR, TcoI uLrIsTe Y1, anA dD VCAheNmCisEtDry 2C01O UorR SitEs .eqFuaivllaletnert.mL. ecCturerdesit, TthrTehe pSroA8d. usCctutaidlodynwoefallnthd1e4o3sfo. ilPthraoesfeapssrsooorpuer-cr-t-ei-e-o-s-f--t-ah.ned muisneeraolf nluimtriienngtsmnaeteedrieadlsf,orfeerftifleiczteirvse, carnodp manures. malit[sAe2sri0nos7ant.utedoSyfOyteohIafLerspi.PhnysPHtsrriYiucmScaltaIoCrpril.Sryo,ApfsLeosrEroticCegisaTrtaeUadnuRPdarEotpeSfre.osscstFuoeasrdslelRens.ttseoD.rfm.Ps.MoreiClirsle,rlqeweudriiistt.hi]tteNhe,rmoectepoghuiharvssoeeiusnrs1oi.0nn7G1thio9ve5re3nfp-u5ein4rn­­. damental physical principles involved. lwCimri2tLehi0dtae8ibddt.o.itfrPhfaMerHteoreeYrWnySthIoe2pCux-hAre4ysr:L.sc3iic0sMae.PsluRCsataOannlbddPdewEpepRdhlrelyTemscI2iEe9ood4ncSe.hsdteArmOaostiFsircooanaclsicSactOteoedcImehLPsnpSrigoia,qnnfueeiesLedsdsAortBuboysROe.dfcRaoDmAiun.TrislMOiesaorRii2illzY0le7i.en.rvth.EFeesnatlrilogslatluttmiedoreenmnns.tt. th 2 e 0p9r.ofResEsoS rEiaAl RsCtafHf. I N SO IL SC IE N C E . Fall and spring terms. All members of one210to. SthErLeeE ChToEurDs. TPOrePreI qCuSisiItNe, SteOnI LcrSedCiItE hNoCuErs. iFnallSoainl dSscpiernincge. teTrimmse. Ctoredbiet aFrarlalntgeerdm. : (a) S O I L S T R U C T U R E . Credit one hour. Associate Professor R. D. M il l e r . (c) Spring TteOrmP I: C TO BE ARRAN G ED . Credit from one to three hours. Staff. (a) S O I L M O I S T U R E . C redit one hour. Associate Professor R. D. M i l l e r . (b ) I O N I C E Q U I L I B R I A I N SOI L S . C redit one hour. Professor P e e c h . (c) T O P I C T O B E A R R A N G E D . C redit from one to three hours. Staff. FIELD CROPS 2. I N T R O D U C T I O N T O F I E L D C R O P S . Spring term . C red it three hours. O pen to freshmen. U pperclassm en and others who have the prerequisites should take course 11 r a th e r th a n 2. D iscussion period. W F 10. C aldw ell 100. L ab o ra ­ tory, M T W T h or F 2-4:30. Caldwell 250. Professor H a r tw ig . A study of the culture of the com m on field crops th at are produced in the N ortheastern States, with emphasis on the practical aspects. Rotations w ith their seed and fertilizer requirem ents are worked out for three or four type-farms where the objective is to produce feed a n d food. P R O D U C T I O N O F F I E L D C R O P S . Fall term . C redit four hours. Pre­ requisite, a course in soils. G rad u ate students m ust consult the instru cto r before M Wregistering. A uditors n o t p e rm itte d . L ectures, F 10. C aldw ell 100. L abora­ M T W Th H .tory, o r F 2 -4 :3 0 . C aldw ell 250. Professor artwig A course dealing principally w ith the crops th a t are used fo r feeding livestock and poultry. Em phasis is placed on the hay, silage, p asture, and g ra in crops of the N ortheastern States. C u ltu ral m ethods, crop rotations, fertilizer practices, soil and clim atic adaptation, and the better varieties of the im portant crops are considered. 211. S P E C I A L T O P I C I N F I E L D C R O P S . Fall and spring terms. C redit one or two hours. M eeting once weekly for graduate students and undergraduate m ajors. Professors H a r t w i g , K e n n e d y , M a c D o n a ld , and M u s g r a v e . 112. P A S T U R E A N D H A Y C R O P S . Spring term . C redit three hours. For ju n io rs, seniors, a n d g ra d u a te students. P rereq u isite, courses 1 a n d 11 o r th e ir equivalent, or 2 and 6 by permission. Lectures and discussions. T T h S 8. Caldw ell 100. T hree to five required field trips in A pril and M ay, M T W T h o r F 1:30-5. Professor K e n n e d y . T he establishm ent, m aintenance, productivity, use, and quality of various pasture and hay crops are discussed, especially those for hum id, tem perate climates. Practi­ cal applications are emphasized. O f particular value to those interested in agron­ omy, anim al production, and soil conservation. [213. C R O P E C O L O G Y . Fall term . C redit three hours. Given in alternate years. P rereq u isite, course 11 a n d B otany 31 o r th e ir eq u iv alen t. Professor M u s ­ g ra v e .] N ot given in 1953-54. An analysis of the environm ent of crop plants and their ecological responses, w ith emphasis on the cereals and on the legumes and grasses for forage. 214. G R A S S L A N D S A N D G R A S S L A N D R E S E A R C H . Fall term . C redit three hours. Prerequisite, course 112, P lant Breeding 102 or 203, and Botany 31, or their equivalent, an d perm ission to register. T T h S 10. C aldw ell 31. Professor M a c ­ D o n ald . A study of factors underlying the developm ent and m aintenance of grassland types and the principles and practices of grassland and forage-crop investigations. 219. R E S E A R C H I N F I E L D - C R O P P R O D U C T I O N . Fall, spring, and sum ­ m er term s. Professors H a r tw ig , K e n n e d y , M a c D o n a ld , and M u s g r a v e . DEPA RTM EN TA L SEM INAR 290. S E M I N A R . Fall and spring terms. Required of graduate students taking work in the departm ent, S 11-12:30. Caldwell 100. ANIMAL HUSBANDRY S tu d en ts are advised to register for courses 1, 10, a n d 20 before tak in g th e m ore advanced courses. LIV ESTO CK PRO D U CTIO N 1. I N T R O D U C T O R Y L I V E S T O C K P R O D U C T I O N . F a ll term . C re d it th ree hours. L ectures, W F 8 or 10. W ing A. L aboratory, T T h or F 2-4:30, W 11-1. Judging Pavilion. Assistant Professor S h e f f y and assistants. A survey course th at gives the student a concept of the scope of the anim al in­ dustry, an insight into the opportunities it offers, and perception of its fundam ental problems. It includes the fundam entals of successful livestock production th at form a foundation on w hich to build specialized knowledge and skill in succeeding courses. It should serve equally well for students m ajoring in other fields, w ho will take but one course in A nim al H usbandry. Animals specifically covered are beef cattle, sheep, swine, and horses. Tw o scheduled evening prelim s are given. 10. L I V E S T O C K F E E D I N G . Fall or spring term . C red it four hours. P rerequi­ site, Chem istry 101, 105, or Biochemistry 2. L ectures: fall term , M W F 11; spring term , M W F 9. W ing A. L aboratory: fall term , T h or F 2-4 :20 , W ing A ; spring term , M W T h or F, 2-4:20. W ing C. Professor S. E. S m ith , Assistant Professor W a r n e r , and assistants. T he feeding of farm animals, including the general basic principles, feeding standards, the com putation of rations, and the composition and nutritive value of livestock feeds. H E A L T H A N D D I S E A S E S O F A N I M A L S (V E T E R I N A R Y 61). Spring term . C redit three hours. N ot open to freshm en or to those who have had no courses in anim al husbandry. L ectures, M W F 11. V eterin ary College. Professor G i l m a n . T he course is designed to give the student a clear conception of the causes and nature of the diseases of animals, w ith suggestions for their prevention. Special atten­ tion is given to the m ethods of preventing the spread of the infectious and epizootic diseases. Such inform ation as is practicable is given for the treatm en t of slight in ­ juries and for first aid in emergencies. 41. L I V E S T O C K J U D G I N G : B E E F C A T T L E , H O R S E S , S H E E P , A N D S W I N E . F all term . C re d it tw o h ours. P rereq u isite, course 1. L ectu re a n d lab o rato ry period, W 2-5:10. Judging Pavilion. Professor J. I. M i l l e r . A beginning course in judging m arket and breeding classes of beef cattle, horses, sheep, and swine, w ith m ajor emphasis on a detailed study of the type of livestock which best meets present-day demands. 42. L I V E S T O C K J U D G I N G : B E E F C A T T L E , H O R S E S , S H E E P , A N D S W I N E . Spring term . C redit two hours. Prerequisite, course 41 or permission to register. M T h 2-4:20. Students m ay register for only one laboratory period for one hour of credit by permission of instructor. Professor J. I. M i l l e r . A course in jud g in g m arket and breeding classes of beef cattle, horses, sheep, and swine, w ith m ajor emphasis on a study of the type of breeding stock w hich best m eets m odern dem ands. O ne field trip of about two days’ d u ratio n is m ade to give a dditional opportunities to study livestock in outstan d in g herds o r flocks. 43. A D V A N C E D L I V E S T O C K J U D G I N G . Fall term . C redit two hours. Reg­ istration by permission. M F 2-4:20. Judging Pavilion and Livestock Barns. Profes­ sor J. I. M i l l e r . An advanced type study of purebred m arket and breeding classes of beef cattle, horses, sheep, and swine. Intended prim arily to give additional training to successful students of course 42. Tw o 2-day trips are taken on week ends. M em bers of this group are selected to represent the institution in intercollegiate judging competitions. 60. B E E F C A T T L E . Spring term. C redit three hours. Prerequisite, course 1 or perm ission to register. L ectures, W F 10. W ing B. L ab o ra to ry , F 2 -4 :2 0 . Ju d g in g Pavilion and Beef C attle barn. Professor J. I. M i l l e r . A general course in beef-cattle production. T he m anagem ent, feeding, breeding, selection, and m arketing problems involved in the beef-cattle enterprise are em pha­ sized. A one-day field trip is taken to study successful beef p ro d u c tio n m ethods. 70. S W I N E . Spring term . C redit three hours. Prerequisite, course 1 or permission to register. L ectures, W F 11. W ing B. Practice, T 2 -4 :2 0 . Ju d g in g Pavilion and Swine Barn. Professor J. P. W i l l m a n . A general course in the care, feeding, breeding, and m anagem ent of swine. Lec­ tures, recitations, and discussions; studies in swine selection; field trips and prac­ tical exercises in the h an d lin g and care of swine. A one-day field trip is taken. 80. S H E E P . Fall term . C redit three hours. Prerequisite, course 1 or perm ission to register. L ectures, T T h 10. W ing B. P ractice, M 2 -4 :2 0 . Ju d g in g P avilion a n d Sheep Barn. Professor J. P. W i l l m a n . A general course in the care, breeding, feeding, and m anagem ent of the farm flock; feeding and fattening of lam bs; practice in judging and handling of sheep and wool. Lectures, recitations, dem onstrations, discussions, reports, and field trips intended to give students a practical knowledge of sheep production. A one-day field trip is taken. 115. A D V A N C E D L I V E S T O C K F E E D I N G A N D A P P L I E D A N I M A L N U ­ T R I T I O N . Spring term . C redit two hours. For advanced and graduate students. Prerequisite, a course in livestock feeding and a course in anim al nutrition. Lec­ tures and discussions, T T h 9. W ing E. Professor M o r r i s o n . This course includes a presentation and discussion of recent developm ents in the feeding and nutrition of farm animals, study of experim ental m ethods, and critical analysis of published data. MEATS 90. M E A T A N D M E A T P R O D U C T S . Fall and spring term s. C redit three hours. L ec tu re , M 8. W ing B. T w o lab o ra to ry periods a w eek, one sla u g h te r section, a n d one cutting section. Slaughter section, T or W 10-12, W 2-4:20, or T h 2-4:20. C u ttin g section, M or T 1-3, or M 3-5. R egistration lim ited to sixteen students in each cutting section and to twelve students in each slaughter section. Professor J. I. M i l l e r , Associate Professor W e l l i n g t o n , and M r. S c h u t t . A course in slaughtering of m eat anim als, cutting of carcasses into retail cuts; identification and grading of carcasses; and the preservation of meats. 92. M E A T A N D M E A T P R O D U C T S . Fall or spring term . C redit two hours. For women students. N ot open to freshm en. Designed prim arily for students in the College of H om e Economics. R egistration lim ited to sixteen students in each laboratory section. L ecture, T h 11. W ing B. L aboratory, T h o r F 2 -4 :2 0 . M eat L aboratory. Associate Professor W e l l i n g t o n and the Poultry D ep artm en t staff. A course dealing w ith the m ajor phases of m eats, poultry, and eggs; wholesale and retail buying, nutritive value of m eats, cutting, freezing, curing, canning, cook­ ing, and m iscellaneous topics. 93. M E A T C U T T I N G . Fall or spring term . C redit one hour. Prerequisite, course 90 or 92, and perm ission to register. E nrollm ent lim ited to five students each term . O ne laboratory period each week, time to be arranged w ith the instructor. Messrs. S c h u tt and H o lle y . T his course offers supervised practice in m eat selection, cutting, and grading for students intending to specialize in m eats work. 94. M E A T J U D G I N G . Fall term . C redit one hour. Prerequisite, course 90. R egistration lim ited to sixteen students. L ecture and laboratory period, W 11-1. M eat Laboratory. Associate Professor W e l l i n g t o n . A course in m arket classes and grades of m eat, judging, selection, and identifica­ tion of carcasses and cuts. Field trips and some evening classes are included to pro­ vide additional experience. DAIRY HUSBANDRY 50. D A I R Y C A T T L E . Fall o r spring term . C re d it four hours. C ourses 10 and 20 are recom m ended before registering for this course. Lectures: fall term , T Th S 8 ; spring term , T T h S 10. W ing A. L ab o ra to ry : fall term , M 2 -4 :2 0 , spring term , M or T h 2-4:20. W ing A and Judging Pavilion. Professor T u r k , Associate Professor S c h u l t z , and assistants. T his course deals w ith some of the economic aspects of the dairy industry; study of dairy breeds; factors in breeding and developm ent of dairy cattle; milking m eth­ ods and m ilk production problem s; efficient feeding; and care, m anagem ent, and health of the dairy herd. Practice in selection, herd m anagem ent, form ulating of rations, planning of breeding program s, and keeping of records. 51. D A I R Y - C A T T L E J U D G I N G . Spring term . C redit two hours. Prerequisite, course 50. Practice, W 2-4:20 and S 10-12. (In the last half of the semester, the W ednesday m eetings are discontinued and the class m eets all day S aturday.) Judging Pavilion. Professor T r im b e r g e r . A beginning course in the selection and judging of all breeds of dairy cattle. Practice includes all-day trips on Saturday during the latter p art of the term to herds in the State. 52. A D V A N C E D D A I R Y - C A T T L E J U D G I N G . Fall term . C redit one hour. Prerequisite, course 51. R egistration by permission. Practice hours to be arranged. Professor T r im b e r g e r . T his course is inten d ed prim arily to give ad d itio n al train in g in com parative judging to successful students of Course 51. M em bers of the class are selected to represent the institution in intercollegiate judging competitions. *53. D A I R Y P R O D U C T I O N . Fall term. C redit two hours. Enrollm ent lim ited to one-year stu d en ts in d a iry industry. M W 1. W ing B . -------------- . A lecture-dem onstration and discussion course on classes, housing, feeds and feeding, and m anagem ent of dairy cattle. 150. A D V A N C E D D A I R Y P R O D U C T I O N . Spring term . C redit three hours. Prerequisite, course 50. O pen only to juniors and seniors. L ectures, T T h 11. L ecture and discussion, T 2-4:20. W ing A . Professor T r im b e r g e r . Analysis of breeding and m anagem ent program s in successful herds. Evaluation of the program s of dairy-cattle breed associations. Em phasis is placed on the ap­ plication of the principles of dairy breeding, feeding, and m anagem ent to the de­ velopm ent and operation of a successful dairy farm . ANIM AL BREEDING AND PH Y SIO LO G Y OF R E PR O D U C T IO N 20. A N I M A L B R E E D I N G . Fall term . C redit three hours. Prerequisite, Botany 1, Biology 1, o r Zoology 103 a n d 104. L ectures, M W 9. W ing A. R e citatio n , dem ­ onstration, and laboratory, M T W T h or F 2-4:20. W ing C. Associate Professor R. W. B r a t t o n , Assistant Professor F o o t e , and assistants. An introduction to the anatom y and physiology of reproduction and the im prove­ m ent of farm anim als through the application of genetics. 120. P R O B L E M S I N A N I M A L B R E E D I N G . Fall term . C redit three hours. Prerequisite, course 20 or P lan t B reeding 101. L ectures, T T h 11. L aboratory, W or F 2-4:20. W ing E. Professor H e n d e r s o n . * Course 53 will n o t be given unless a t least ten stu d en ts have been accepted for the one-year curric­ ulum in dairy manufacturing and marketing by June 1,1953. A consideration of the problem s involved in the im provem ent of the larger farm anim als and the application of genetics in their solution. 125. P H Y S I O L O G Y O F R E P R O D U C T I O N . Spring term . C redit two hours. O pen to graduate students and upperclassmen. Prerequisite, a course in hum an or veterinary physiology. L ectures, M W 10. W ing C. Professor A s d e l l . An advanced course in reproduction, principally in mammals. 126. A P P L I E D A N I M A L P H Y S I O L O G Y . Fall term . C red it one hour. O p en to upperclassm en and grad u ate students. T 9. W ing B. Professor A s d e l l . T he application of physiological m ethods to grow th, reproduction, and lactation in farm animals. 127. E L E M E N T A R Y E N D O C R I N O L O G Y . Fall term . C redit two hours. T T h 10. W ing C . Associate Professor H a n s e l . A general course in the physiology of the endocrine system. L ectures and dem ­ onstrations showing the effects of the horm ones of the endocrine glands and the roles played by each in the regulation of norm al body processes. ANIM AL N U T R IT IO N 110. P R I N C I P L E S O F A N I M A L N U T R I T I O N . Fall term . C red it three hours. For seniors and graduate students. Prerequisite, a course in hum an or veterinary physiology and a course in organic chemistry or biochemistry. Lectures, M W F 10. Savage 100. P rofessor L o o s l i . T he chem istry and physiology of nutrition and the nutritive requirem ents for grow th, reproduction, lactation, and other body functions. 111. L A B O R A T O R Y W O R K I N A N I M A L N U T R I T I O N . Fall term . C redit three hours. Prerequisite, Q uantitative Analysis. M W F 2-4:20. Stocking 160. Professor M c C a y . Each student engages in a series of small research projects w ith living anim als, such as rats, dogs, and other anim als, w here both classical techniques, such as chem ­ ical balance studies, and very m odern ones are taught. T he use of anim als and the application of biochem ical m ethods in advancing the science of nutrition are in­ cluded. 210. S P E C I A L T O P I C S I N A N I M A L N U T R I T I O N . Spring term . C redit one hour. R egistration by permission. T h 8. W ing E. Professors L o o s l i , M c C a y , and S. E. S m i t h . A presentation and discussion of the knowledge and techniques of special fields of anim al nutrition, w ith particular reference to farm animals. 215. H I S T O R Y O F N U T R I T I O N . Fall term . C redit one hour. T h 4 :1 5 . Savage 130. Professor M cCay. T h e purpose of the course is to fam iliarize the stu d en t w ith the background lite r­ ature in nutrition and to improve his technique in using the libraries. E ach student prepares four w ritten reports and summarizes these in brief oral reports to learn better ways to present technical information. 219. S E M I N A R I N A N I M A L N U T R I T I O N . Fall term . C redit one hour. O pen to graduate students w ith m ajor field of study in anim al nutrition. R egistration by permission. T 4 :3 0 . Rice 201. Anim al N utrition staff. A critical review of the literature and other topics of special interest to graduate students in anim al nutrition. DEPA RTM EN TA L RESEARCH AND SEM INAR 200. R E S E A R C H . Fall and spring trems. C redit and hours by arrangem ent. For graduate and advanced students only. All m em bers of Professional staff. Profes­ sor T u r k in charge. 201. S E M I N A R . Fall and spring terms. R equired of all graduate students taking either a m ajor or a m inor subject in Animal Husbandry. Advanced undergraduates are adm itted by perm ission, and, if a satisfactory rep o rt on an approved subject is presented, m ay receive not to exceed tw o hours credit. M 11. Professor T u r k and departm ental staff. BACTERIOLOGY Students are accepted as m ajors in bacteriology only upon consent of the head of the D epartm ent or of a m em ber of the staff designated to act for him. Acceptance is g ra n te d only to those stu d en ts w ho follow th e p rescribed courses ou tlin ed by the D epartm ent and whose scholastic records are entirely satisfactory. 1. G E N E R A L B A C T E R I O L O G Y . F a ll term . C re d it six hours. P rereq u isite, C hem istry 102 or 106. L ectures, M W F 11. Stocking 218. L aboratory practice, M W F 2-4:30. Stocking 301. Associate Professor S e e le y and assistants. An introductory course; general survey of the field of bacteriology, w ith the fun­ dam entals essential to further work in the subject. 2. G E N E R A L B A C T E R I O L O G Y . Fall term . C redit three hours. Prerequisite, Chem istry 102 or 106. N ot open to undergraduate students in the College of Ag­ riculture. Lectures, M W F 11. Stocking 21 8 . Associate Professor S e e le y . T h e sam e as the lec tu re p a r t of course 1. By special perm ission, this course m ay be elected by graduate students and advanced students in certain professional courses, such as Chem ical Engineering. 3. A G R I C U L T U R A L B A C T E R I O L O G Y . F all term . C re d it th ree hours. P ri­ m arily for freshm en and two-year students. N ot accepted as prerequisite for ad­ vanced courses. Lectures, M W F 9. Stocking 218. Professor N a y l o r . T he elem ents of bacteriology, w ith a survey of the relations of m icroorganism s to agriculture. 4. H O U S E H O L D B A C T E R I O L O G Y . Spring term. C redit three hours. Pre­ requisite, Elem entary Chemistry. Lim ited to students in Hom e Economics. Lectures, T T h 10. Stocking 218. L aboratory, T T h 8 -9 :5 0 or T T h 11-12:50. Stocking. Assistant Professor V a n D e m a r k and assistants. An elem entary, practical course for students in Hom e Economics. 103. A D V A N C E D B A C T E R I O L O G Y . Spring term . C red it six hours. P rereq­ uisite, course 1, q u a n tita tiv e analysis, a n d o rg an ic chem istry. L ectu res a n d la b o ra ­ tory practice, M W F 2-5:30. Professor S h e r m a n , Associate Professor S e e l e y , and assistants. A systematic study of the im portant groups of bacteria th at are of significance in w ater, milk, foods, and industry, together w ith the m ethods used in these fields of bacteriology. 105. H I G H E R B A C T E R I A A N D R E L A T E D M I C R O O R G A N I S M S . Fall term . C re d it fo u r hours. P rereq u isite, course 1. L ectures, recitatio n s, a n d lab o ra to ry practice, T T h 1 :4 0 -5 . Stocking 119 and 323. Professor K n a y s i and assistant. A study of the higher bacteria, together w ith the yeast and molds th at are of especial im portance to the bacteriologist. S O I L M I C R O B I O L O G Y (A G R O N O M Y 106.) F a ll term . C re d it th ree h ours. Prerequisite, course 1 and Chem istry 201 or its equivalent. Lectures, M W 8 . C ald­ well 31. Laboratory, F 2-4:30. Caldw ell 201. Professor B r o a d b e n t. A course in biological soil processes designed prim arily for students specializing in soil technology or bacteriology. T h e laboratory work is supplem ented by reports and by abstracts of im portant papers on the subject. P A T H O G E N I C B A C T E R I O L O G Y . (See th e A n n o u n c e m e n t of the N e w York State Veterinary College.) 210. P H Y S I O L O G Y O F B A C T E R I A . Fall term . C redit two hours. Prerequisite, course 1 and at least one additional course in bacteriology and one in organic chem­ istry. L ectures, T T h 10. Stocking 120. Associate Professor D e l w i c h e . T he physiology of bacteria and the biochem istry of m icrobic processes. 212. S E L E C T E D T O P I C S I N B A C T E R I O L O G Y . Fall and spring terms. C redit one hour a term. For seniors and graduate students. F 8. Stocking 120. Staff. 213. M O R P H O L O G Y A N D C Y T O L O G Y O F B A C T E R I A . Fall term . C redit three hours. For seniors and graduate students. Lectures, T T h S 9. Stocking 119. Professor K n a y s i. T he m orphology, cytology, and m icrochem istry of m icroorganisms. 215. C H E M I S T R Y O F B A C T E R I A L P R O C E S S E S . Spring term . C red it two hours. F or seniors and graduate students. L ectures, M W 11. Stocking 120. Associate Professor D e lw ic h e . T he chemistry of metabolism , ferm entation, and nutrition of microorganisms. 216. G E N E T I C S O F M I C R O O R G A N I S M S . Spring term . C redit two hours. For seniors an d g rad u ate students. L ectures, M W 12. Stocking 119. Professor Z e l l e . An advanced course for students who have had thorough basic training in bac­ teriology and genetics. 220. R E S E A R C H . Fall or spring term. C redit one or more hours, by arrangem ent. For advanced students. Assistant Professor V a n D e m a rk . Special problems in any phase of bacteriology may be elected. 221. S E M I N A R . Fall and spring terms. W ithout credit. H ours to be arranged. Stocking. Staff. BIOCHEMISTRY AND NUTRITIO N 2. I N T R O D U C T O R Y A G R I C U L T U R A L C H E M I S T R Y . Fall term . C red it five hours. O pen only to tw o-year students in the College of A griculture. L ectures and recitations: M W F 9. P lant Science 233; T T h 9. Caldw ell 100. Associate Professor N e a l and assistants. Lectures, demonstrations, and recitations dealing w ith the fundam ental principles of chem istry and th eir application to ag ricu ltu ral practices. T his course is n o t ac­ cepted as a prerequisite for further courses in Chem istry or Biochemistry. 5. A G R I C U L T U R A L B I O C H E M I S T R Y . Spring term . C red it three hours. P re­ requisite, Chem istry 102 or 106 or the equivalent. M ay not be taken for credit by students who have completed a more advanced course in this D epartm ent. Lectures, M W F 11. Savage 100. Associate Professor N e a l . An elem entary course for the general agricultural students, dealing w ith the bio­ chemistry of crop and anim al production, of the m aterials concerned, such as feeds, fertilizers, and insecticides, and of the products th at result. 10. E L E M E N T S O F B I O C H E M I S T R Y , L E C T U R E S . F all term . C re d it four hours. Prerequisite, Chemistry 303 and 305 or Food and N utrition 215. Lectures, M T T h S 8. Savage 145. Associate Professor D a n ie l . Prim arily for students in the College of H om e Economics. A n elem entary course dealing w ith the chemistry of biological substances and their transform ations (di­ gestion and m etabolism ) in the anim al organism. 11. E L E M E N T S O F B I O C H E M I S T R Y , L A B O R A T O R Y . F all term . C re d it two hours. Prerequisite or parallel, course 10. L aboratories, T T h 2-4 :20 or W 2-4:20 and S 9-11:20. Savage 210. Associate Professor D a n i e l and assistants. Laboratory practice w ith biochem ical substances and experim ents designed to illustrate chemical reactions which may occur in the anim al body. 101. G E N E R A L B I O C H E M I S T R Y 3 L E C T U R E . Fall term . C red it four hours. Prerequisites, Chemistry 215 or the equivalent; and 303 and 305 or the equivalent. Lectures, M W F S 11. Savage 100. Professor W i l l i a m s . For graduate and advanced undergraduate students, dealing w ith the chemistry of p lan t and anim al substances and the reactions occurring in biological systems. 102. G E N E R A L B I O C H E M I S T R Y , L A B O R A T O R Y . Fall term . C redit two hours. Prerequisite or parallel, course 101. Laboratory, M W or T T h 2-4:20. Savage 230. Professor W illia m s and assistants. Laboratory practice w ith plant and anim al m aterials and the experim ental study of their properties. 130. P R I N C I P L E S O F F O O D P R E S E R V A T I O N . Spring term . C red it two hours. Prerequisite, Biochem istry or O rganic C hem istry. L ectures, T T h 10. Savage 145. A discussion of the basic physical, chem ical, and biological principles of food preservation and their application in refining, dehydration, cold storage, freezing, canning, ferm entation, chem ical preservation, an d packaging. T h e effects of food' processing upon the m aintenance of nutritive value and on other food qualities. 140. S E L E C T E D T O P I C S I N F O O D B I O C H E A I I S T R Y . Spring term . C redit tw o hours. G iven in a lte rn a te years. P rereq u isite, course 101. L ectures, M W 10. Savage 145. A discussion of some of the im portant nonm icrobial changes in foods, such as d en atu ratio n and the M aillard brow ning reaction. E m phasis is placed on the occur­ ence, significance, and prevention or control of the changes as they affect the color, odor, flavor, texture, or nutritive value of foods. 201. B I O C H E M I S T R Y O F L I P I D S A N D C A R B O H Y D R A T E S . Spring term. C redit tw o hours. Prerequisites, courses 101 and 102 and Physical C hem istry 405 and 406, or the equivalent. Lectures M W 9. Savage 100. Professor S u m n e r and Associate Professor W. L. N e l s o n . Discussion of the properties and biological role of the lipids and carbohydrates. 202. B I O C H E M I S T R Y O F P R O T E I N S A N D E N Z Y M E S . Spring term . C redit two hours. Prerequisite, courses 101 and 102 and Physical C hem istry 405 and 406, or the equivalent. Lectures, T T h 9. Savage 100. Professor S u m n e r. Discussion of the properties and biological role of proteins and enzymes. 203. A D V A N C E D B I O C H E M I S T R Y . Laboratory. Spring term . C redit three hours. Prerequisite, to accom pany or follow courses 201 and 202. Lim ited enroll­ m ent. R egistration by permission of the instructor only. M W 2-5. Savage 230. Professor S u m n e r and Associate Professor W. L. N e l s o n . Laboratory experiments dealing w ith enzymes, co-factors, and substrates of im­ portance in m etabolic processes. Practice is given in the use of special techniques em ­ ployed in isolation, characterization, and m ode of action of enzymes and enzyme systems. Em phasis is placed on in terp retatio n of d a ta and w ritten reports covering the various experiments. 210. P L A N T B I O C H E M I S T R Y . Spring term . C redit two hours. Given in al­ tern ate years, Prerequisite, courses 101 and 102 o r the equivalent. L ectures, T T h 11. Savage 145. Associate Professor N e a l . Lectures and discussion of biochem ical topics of particular interest to students in plant sciences. 220. S P E C I A L T O P I C S I N N U T R I T I O N . Spring term. C redit one hour. Pri­ m arily for graduate students. Prerequisite, a course in biochem istry and a course in nutrition. R egistration by permission. T 8. Savage 145. Professor M a y n a r d . 290. B I O C H E M I S T R Y S E M I N A R . Fall term . C redit one hour. R equired of m ajors and minors. Prerequisite, courses 201 and 202, or the equivalent. R egistra­ tion by permission. M 4 :1 5 . Savage 100. Professor S u m n e r and staff. Assignment sand discussions of recent advances in biochemistry. 292. N U T R I T I O N S E M I N A R . Spring term . C redit one hour. R egistration by permission. M 4 :1 5 . Savage 100. Professor M a y n a r d and staff. Assignments and discussions of recent adavnces in the biochem istry and physiol­ ogy of nutrition. 294. R O O D B I O C H E M I S T R Y S E M I N A R . Fall term . C redit one hour. R eg­ istration by permission. T 4 :3 0 . Savage 130. Assignments and discussions of literature pertaining to the biochem ical aspects of foods and food processing. BOTANY Students in botany m ay be accepted as specializing students at the end of their sophomore year only upon approval of the D epartm ent of Botany. T hey are required to take certain prescribed courses and m ust m aintain a high scholastic average. Students wishing instruction in special groups of plants or in special subjects should consult the D epartm ent. 1. G E N E R A L B O T A N Y . F a ll a n d sp rin g term s. C re d it th re e h o u rs a term . If taken a fte r Biology 1, cred it tw o hours a term . T his course m ay be b egun in the spring term . L ectures, T T h 9 or 11. P lan t Science 233. O ne laboratory a week, M T W T h or F 2-4:30, T 10-12:30, F or S 8-10:30, or S 9-11:30. P lant Science 240, 242, and 262. Professor P e t r y , instructors, and assistants. A survey of the fundam ental facts and principles of p lan t life. T he work of the first term deals w ith the structures and functions of the higher plants, w ith special emphasis on their nutrition. T he work of the second term traces the evolution of the plant kingdom, as illustrated by representatives of the principal groups, and con­ cludes w ith a brief introduction to the principles of classification of the flowering plants. 3. P O I S O N O U S P L A N T S . F a ll o r sp rin g term . C re d it one h o u r. R e g istra tio n is lim ited to stu d en ts in th e V e te rin a ry College. L ectu res, T h 8. L ab o ra to ry , T h 2-4:30. P lan t Science 202. Professor M u e n s c h e r . Em phasis is given to the recognition of the p rincipal kinds of stock-poisoning plants. 55. W E E D S A N D P O I S O N O U S P L A N T S . Fall term . C redit three hours. Pre­ requisite, course 1 or its equivalent. L ecture, F 9. L aboratory, W F 2-4:30. Plant Science 202. Professor M u e n s c h e r . Special em phasis is given to the habits, characteristics, and properties w hich m ake weeds and poisonous plants harm ful or undesirable, the losses and in jury produced by them and the m ethods for their prevention, eradication, and control. 56. S E E D A N A L Y S I S . Spring term . C redit one hour. Prerequisite, course 1 or its equivalent. Lectures and laboratory, F 2-4:30. P lant Science 202.. Professor M uenscher. A course designed for students in the applied plant-science departm ents and those interested in p reparing to be seed analysts. Practice is given in m aking p u rity analyses and germ ination tests according to standard and official m ethods and recom m enda­ tions. Students wishing to become seed technologists m ay arrange to take advanced work under course 171. 115. A Q U A T I C P L A N T S . Spring term . C redit three hours. Prerequisite, course 1 or its equivalent. L ecture, M 9. L aboratory, M W 2-4:30. P lan t Science 203. Professor M u e n s c h e r . A study of the taxonom y and ecology of fresh-w ater plants, beginning w ith the algae and concluding w ith the acquatic angiosperms. 117. T A X O N O M Y O F V A S C U L A R P L A N T S . Fall term . C redit four hours. Prerequisite, course 1 or its equivalent and permission to register. Lectures, T T h 9 P lant Science 143. Laboratory, T T h 2-4:30. M ann 464. Professor C l a u s e n . A survey of the kinds of seed plants and ferns, their classification, gross m orphol­ ogy, geographical distribution, and economic im portance, together w ith an introduc­ tion to the principles and literature of taxonomy. M ethods of identification are stressed. 118. T A X O N O M Y O F V A S C U L A R P L A N T S , A D V A N C E D C O U R S E . Spring term . C redit four hours. Prerequisite, course 117 and either course 124 or P lant B reeding 101 a n d perm ission to register. L ectures, T T h 9. P la n t Science 143. L ab- oratory, T T h 2-4:30. M ann 464. Professor C la u s e n . A continuation of course 117, including a consideration of evolutionary patterns in the seed plants and ferns; a dem onstration of the principles and m ethods of taxonomy; and an introduction to problems of classification in the flora of N orth America. T rips are scheduled in laboratory periods and on several Sundays in the second half of the term. 217. S E M I N A R I N T A X O N O M Y O F V A S C U L A R P L A N T S . Fall and spring terms. Prerequisite, course 118. R equired of graduate students taking work in tax­ onom y. Conference, M 4:30. M ann 464. Professor C la u s e n . A consideration of current research and literatu re; reports on problems of research by graduate students and m em bers of the staff. 123. P L A N T A N A T O M Y . Fall term . C redit four hours. Prerequisite, course 1 or its equivalent and permission to register. Lectures, T T h 9. P lant Science 37. Laboratory, either M W 2-4:30 or T T h 10-12:30. Plant Science 211. Professor Ba n k s. . A detailed study of the internal structure of vascular plants w ith emphasis on de­ term ination and interpretation. 124. C Y T O L O G Y . Fall term . C redit four hours. Prerequisite, course 1 or Zool­ ogy 102 or 104 or the equivalent. Lectures, M W 9. P lant Science 143. Laboratory, M W or T T h 10-12:30. Assignments to laboratory section m ust be m ade at time of registration. P lant Science 219. Associate Professor U h l . T he principal topics considered are protoplasm , cells and their components, nuclear and cell division, meiosis and fertilization, and the relation of these to the problems of developm ent, reproduction, taxonomy, and heredity. Both p lant and anim al m aterials are used. M icrotechnique is no t included. [125. M I C R O T E C H N I Q U E . Spring term . C redit two hours. Prerequisite, course 1 a n d permission to register. Associate Professor U h l . ] N ot given in 1 9 5 3 -5 4 . A laboratory course in m ethods of preparing plant m aterial for microscopical study. [224. C Y T O G E N E T I C S . Spring term . C redit three hours. Prerequisite, course 124 an d P lan t B reeding 101 or the equivalent. Professor R a n d o l p h .] N o t given in 1953-54. An advanced course dealing mainly w ith the chromosome m echanism of heredity and w ith recent researches in cytology, cytotaxonom y, and cytogenetics. 126. M O R P H O L O G Y O F V A S C U L A R P L A N T S . Spring term . C redit three hours a term . Prerequisite, course 1 or its equivalent, and perm ission to register. L ectures, M W 11. P lant Science 141. L aboartory, M W 2 -4 :3 0 . P lant Science 211. Professor B a n k s . An advanced course in the com parative m orphology, life histories, and phylogeny of the lower vascular plants, both fossil and recent. [127. M O R P H O L O G Y O F V A S C U L A R P L A N T S . Spring term . C red it three hours. Prerequisite, course 1 or its equivalent, and permission to register. G iven in alternate years. Professor B a n k s .] N ot given in 1953-54. An advanced course in the com parative m orphology, life histories, and phylogeny of the higher vascular plants, both fossil an d recent. C O M P A R A T I V E M O R P H O L O G Y O F F U N G I . Given in the D epartm ent of Plant Pathology. 31. P L A N T P H Y S I O L O G Y . Fall or spring term . C redit four hours. Prerequisite, course 1 or Biology 1 an d in tro d u cto ry chem istry. L ectures, T T h 10. P lan t Science 143. Laboratory, T T h, or W F 2-4:30, or M 2-4:30, and S 8-10:30. P lant Science 227. Visiting Professor B ro w n . T his course is designed to acq u ain t the student w ith the general principles of plant physiology. Topics such as w ater relations, photosynthesis, translocation, di­ gestion, respiration, m ineral nutrition, grow th, and reproduction are studied in detail. P articu lar em phasis is placed, b o th in lab o rato ry an d classroom, on the dis­ cussion of principles and their application to plants. 231. P L A N T P H Y S I O L O G Y , A D V A N C E D L E C T U R E C O U R S E . Fall and spring terms. C redit three hours a term . Lim ited to seniors and graduate students. Prerequisite, training in botany and chemistry, to be determ ined in each case by the D ep artm en t. L ectures, M W F 10. P lan t Science 143. Professor S t e w a r d . 232. P L A N T P H Y S I O L O G Y , A D V A N C E D L A B O R A T O R Y C O U R S E . Fall and spring terms. C redit three hours a term . Prerequisite or parallel, course 231. Laboratory, T T h or W F 2-5:30. Plant Science 241. Professor D. G. C l a r k . 233. S E M I N A R I N P L A N T P H Y S I O L O G Y . Fall and spring term s. R equired of graduate students taking work in the departm ent. Conference, F 11. P lan t Science Sem inar Room. Professors D. G. C l a r k and S t e w a r d and Visiting Professor B ro w n . T he discussion of current problems in p lan t physiology; the presentation of re­ ports on the research of graduate students and members of the staff. 234. P L A N T P H Y S I O L O G Y , A D V A N C E D L E C T U R E C O U R S E . Fall term . C redit one hour. Prerequisite, course 231 or adequate preparation in botany and chem istry. W 8. P lan t Science 37. Professor S n y d e r . T his course deals prim arily w ith physiology in relation to horm ones, photoperiodism , and vernalization. 171. SPECIAL P R O B L E M S IN G E N E R A L BOTANY, T A X O N O M Y , M O R ­ PHOLOGY, ANATOMY, PALEOBOTANY, E C O N O M I C BOTANY, CYTOL­ O G Y , A N D P H Y S I O L O G Y . Fall an d spring term s. C red it n o t less th an tw o hours a term . B y appointm ent. Professors B a n k s , D . G. C l a r k , C l a u s e n , M u e n s c h e r , P e t r y , R a n d o l p h , and S t e w a r d and Associate Professor U h l . Students engaged in special problem s or m aking special studies m ay register in this course. T h ey m ust satisfy the in stru cto r u n d e r w hom the w ork is taken th a t their preparation w arrants their choice of problem . CONSERVATION Students desiring to specialize in conservation may obtain a suggested sequence of courses for the four-year period by consulting the D epartm ent. 1. C O N S E R V A T I O N O F W I L D L I F E . F a ll term . C re d it tw o h o u rs. L ec tu re s, T T h 11 a n d occasional evenings. F ern o w 122. Professors S w a n s o n , C l a u s e n , G u is e , W . J. F I a m i lto n , J r ., P a lm , and R a n e y , Associate Professors A y e r s , C o n k ­ l i n , H e w i t t , K e l l o g g , and W e b s t e r , and cooperating specialists. A n introduction to the wildlife resources of N orth A m erica; the im portance of the flora and fauna in our economic and cultural life; the history of wildlife dec­ im ation, the present need for conservation, and the m ethods employed to reestab­ lish the various species. 2. F A R M F O R E S T R Y . Fall term . C redit three hours. L ectures, M W 11. L ab­ oratory M T or W 2-4: 30. Fernow 122. Professor G u is e . Principal trees of New York State w oodlands; identification, silvical requirem ents, and uses; volum e m easurem ents of logs, trees, and stands; grow th and yields; re­ forestation; developm ent of natural and planted stands; utilization and m arketing of tim ber; properties and uses of w ood; wood preservation; sustam ed-yield m anage­ m ent of woodlands. 3. C O N S E R V A T I O N O F N A T U R A L R E S O U R C E S . S p rin g term . C re d it tw o hours. Lectures, T T h 10. Fernow 122. Professor G u is e . T he natural-resource problems of the U nited States; natural resources in na­ tional w elfare; the conservation m ovem ent; public land policies; natural resources of m ajor im portance; use and exploitation; present inventories; problems ot the future; essential points in a national conservation program . 4 M A N A G E M E N T O F W O O D L A N D S . Spring term . C redit three hours. Lec­ tures, M W 11. Fernow 210. Laboratory, M 2-4: 30. Professor G u is e L im ited to those m ajoring in wildlife m anagem ent and allied fields. Forest and type m apping; stock inventories by sam pling m ethods; cover types and ecological relationships; silvicultural m ethods of im proving and regenerating forests; protec­ tion from fire and other injurious agencies; forest-m anagem ent plans; federal and state laws dealing w ith m ajor aspects of forest policy. 8 ELEMENTARY T A X O N O M Y AND NATURAL HISTORY OF VERTE­ B R A T E S . Fall and spring term s. C redit three hours a term . Prerequisite Zoology 103 a n d 104 o r 101 a n d 102. L ec tu re M 8. F ernow 122. L ab o ra to ry , M W 2 -4 :3 0 or T T h 2 -4 '3 0 Fernow 14. Professors W . J. H a m i l t o n , J r . and R a n e y . Lectures on fishes, am phibia, reptiles, birds, and m am m als, dealing w ith the principles of classification and nom enclature, characteristics, relationships, and bionomics of these groups. T he laboratory gives practice in the identification of N orth A m erican species. Field studies of the local fauna are undertaken during the fall and spring. 9. G E N E R A L O R N I T H O L O G Y . Spring term . C red it three hours. L ecture W 11. Fernow 122. Field work and laboratory, M W or T T h 2-4:30. Fernow 210. Associate Professor K e l l o g g . . Introduction to the study of birds, particularly the local species; their songs and habits. Designed to give a w orking knowledge to those wishing to study birds as an avocation and fundam ental to those planning advanced work in ornithology. Lab­ oratory w ork w ith bird skins is based on the field work. 22 I C H T H Y O L O G Y Spring term . C redit three hours. Prerequisite, course 8 or permission to register. Lectures, T T h 8. Fernow 122. Laboratory, F 2-4:30. Fernow 14. Professor R a n e y . Evolution, relationships, structure, habits, ecology, and literature of fishes. L ab­ oratory studies on structure and identification of N orth A m erican fishes. Field studies on ecology and life histories include one all-day field trip. [23 H E R P E T O L O G Y . S p rin g term . C re d it tw o h ours. P rereq u isite, course 8. Professors W . J. H a m i l t o n , J r . and R a n e y .] N ot given in 1953-54. Structure and classification of am phibia and reptiles; their characteristics, rela­ tionships, and bionomics. 25 M A M M A L O G Y . Fall term . C redit three hours. Prerequisite, course 8 or per­ mission of instructor. Lectures, T T h 8. Fernow 122. Laboratory, F 2-4:30 or S 8-10:30. F ernow 14. Professor W . J. H a m i l t o n , J r . Principal phases of m am m alian life; origin, distribution, habits, and literature. L aboratory periods are devoted to m ethods of field collecting, census taking, life- history studies, p reparation of skins and skeletons, and identification of N orth A m erican species. 101. S E L E C T E D T O P I C S I N C O N S E R V A T I O N . Fall term . C red it one hour. O ne m eeting each week, to be arranged. Fernow 102. Professor S w a n s o n . Prim arily for g ra d u a te stu d en ts w ho are also registered in course 1, b u t open to other graduate students. Discussions of im portant conservation problem s of current interest. 102. P R I N C I P L E S O F W I L D L I F E M A N A G E M E N T . Fall term . C red it three hours. Prerequisite, consent of instructor. Lectures, M W F 10, and two field trips to be arranged. Fernow 122. Associate Professor H e w i t t . Fundam ental mechanisms of wildlife populations j ecological, social, and eco­ nomic aspects of wildlife m anagem ent. 103. W I L D L I F E M A N A G E M E N T M E T H O D S . Spring term . C redit three hours. Prerequisite, consent of instructor. L ecture, F 11. L aboratory, S 8-1. Fernow 212. Several all-day field trips. Associate Professor H e w i t t . M ethods and techniques in the m anagem ent of gam e species and their practical application in the field. Intended for students interested in professional wildlife m anagem ent. 110. E C O N O M I C Z O O L O G Y . Spring term . C redit one hour. Prerequisite, co u rse 8. F 8. Fernow 122. Associate Professor E a d ie . Food habits of mammals of economic im portance; control of injurious species; economics of wildlife resources; conservation legislation. 112. LITERATURE OF ECONOMIC ZOOLOGY, CONSERVATION,AND E C O L O G Y . Spring term. C redit one hour. Lim ited to upperclass students and g rad u ates. W 9. Fern o w 14. Professors W . J. H a m i l t o n , J r . a n d R a n e y a n d Associ­ ate Professor E a d ie . T he literatu re of econom ic zoology, ecology, and kindred fields; fish and fisheries, aquaria, am phibians, and reptiles, their uses; zoological gardens; preserves; game farms, animals in relation to recreation. [122. A D V A N C E D I C H T H Y O L O G Y . Fall term . C redit one or two hours. Pre­ requisite, courses 8 and 22, Elem entary Statistics, and permission of instructor. Lim ­ ited to seniors and graduate students. Professor R a n e y .] N ot given in 1953-54. Lectures (one hour) on speciation, intergradation, hybridization, distribution in fishes, and biom etrical m ethods in vertebrate taxonom y. M ethods of carrying on ecological and life-history investigations. L aboratory (one period) on taxonom ic studies of eastern N o rth A m erican fishes. 126. A D V A N C E D O R N I T H O L O G Y . Fall term . C redit three hours. Prerequisite, course 9 or 8 and permission of the instructor. L ecture and laboratory, T T h 2-5. F ernow 210. P ro fe s s o r-------------- . Structure and classification of birds; geographical distribution; identification of representative birds of the world. Field work on the fall m igration and the identi­ fication of birds in w inter plumage. 131. T E C H N I Q U E S I N O R N I T H O L O G Y . Fall term . C red it three hours. P re­ requisite, courses 8 a n d 9, B otany 1, a n d E ntom ology 12, o r perm ission of in stru cto r. L ecture and laboratory, M W 2-5. Fernow 210. Associate Professor K e l l o g g . For students planning to teach or engage in ornithology or wildlife m anagem ent professionally. Feeding habits of birds, field collecting, preparation of specimens, and photography are em phasized, together w ith classroom, m useum , extension, and survey methods. 133. B I R D S P E C I A T I O N A N D M U S E U M M E T H O D S I N O R N I T H O L O G Y . Spring tenn. C redit three hours. Prerequisite, courses 8, 9, 126, and 131, or permis­ sion to register. Lim ited to seniors and graduate students. Lecture and laboratory, S 8-1. Fern o w 308. P ro fe ss o r-------------- a n d M r. D i l g e r . This course includes such subjects as field and m useum equipm ent; collection and p reparation of bird skins; and the p reparation of taxonom ic papers and avifaunal lists. 136. O R N I T H O L O G Y S E M I N A R . T h ro u g h o u t the year. W ithout credit. R e ­ quired of all graduate students in O rnithology; open to upperclassm en. M 7:30-9 p.m. Fernow 122. L I M N O L O G Y ( E N T O M O L O G Y A N D L I M N O L O G Y 171.) F a ll term . C re d it three hours. See full description under Entomology and Limnology. [173. F I S H E R Y B I O L O G Y . Fall term . C redit three hours. Prerequisite, perm is­ sion of instructor. Associate Professor W e b s te r .] N ot given in 1953-54. T he life histories and ecological requirem ents of some fresh-w ater gam e fishes; and the principles and techniques of fishery m anagem ent. 174. F I S H C U L T U R E . Spring term . C redit two hours. Prerequisite, permission of instructor. L ecture M 12. L aboratory, M 2-4 :3 0 . Fernow 102. Associate Professor A. M . P h i l l i p s , J r. A study of the production of fish in hatcheries and hatchery m anagem ent. [175. F I S H E R Y B I O L O G Y L A B O R A T O R Y . Spring term . C redit two hours. Prerequisite, course 173 and permission of instructor. Lim ited to graduate m ajors and m inors, and to qualified seniors. Associate Professor W e b s te r .] N ot given in 1953-54. Field and biom etrical exercises in fishery m anagem ent. S T R E A M P O L L U T I O N 2531. (O ffered in College of Engineering, but required of fishery biology m ajors.) Elective for advanced Civil Engineering students and for advanced and graduate students outside the School by permission of the D epart­ m ent. F all term . C re d it th ree hours. T h re e re cita tio n s or lectures a w eek. M W F 9. This course deals w ith the pollution of surface, ground, and tidal waters and with the public health, economic and legal problems connected w ith its control. Con­ sideration is given to sources and types of pollution, forces of self purification, p er­ missible pollution loading, pollution surveys, w ater quality standards, classification of w aters, w ater and sewage treatm ent processes, utilization and conservation of w ater resources. 180. O C E A N O G R A P H Y . Fall term . C redit three hours. Prerequisite, general zoology, b otany, chem istry, a n d physics, o r th e equivalents. L ectures, T T h 10. Laboratory, T h 12. Fernow 122. Associate Professor A y e r s . Physical and chem ical aspects of the oceans, particularly as background for m arine ecology; geography and geology of the ocean floor; currents, tides; distribution of tem peratures. Laboratory work in processing oceanographic data. 181. M A R I N E E C O L O G Y . Spring term . C redit three hours. Prerequisite, gen­ eral zoology, chem istry, physics, and either invertebrate zoology or limnology. L ec­ tures, M W F 9. Fernow 122. Associate Professor A y e r s . The sea as an environm ent; the physical and chemical characteristics of m arine habitats; the productivity of the sea; the relation of hydrography to fisheries and faunal distributions. 400-407. R E S E A R C H P R O B L E M S . E ither term . C redit and hours to be ar­ ranged. Problems are undertaken in any of the fields of study in the D epartm ent, but adequate preparation in the specialized field, and permission of the instructor are prerequisites. Fernow Hall. 400. F I S H E R Y B I O L O G Y . Associate Professors W e b s t e r and A. M P h i l l i p s J r. 401. H E R P E T O L O G Y . Professors W. J. H a m i l t o n , J r . and R a n e y . 402. I C H T H Y O L O G Y . Professor R a n e y . 403. M A M M A L O G Y . Professor W. J. H a m ilto n , Jr. 404. O R N I T H O L O G Y . Associate Professor K e l l o g g . 405. W I L D L I F E M A N A G E M E N T . Professor S w a n s o n and Associate Professors E adie and H e w itt. 406. F O R E S T R Y . Professor G u is e and Assistant Professor M o r r o w . 407. O C E A N O G R A P H Y . Associate Professor A y e r s . ^ ^ C O N S E R V A T I O N S E M I N A R . Fall and spring terms. W ithout credit. T 12. S tan. Discussions of literature and current research in the broad field of conservation of birds, m am m als, and fishes. DAIRY INDUSTRY Students intending to specialize in D airy Industry are urged to elect qualitative and quantitative analysis, organic chem istry, and general bacteriology so th at these courses may be completed by the end of the first term of the junior year. 1' I N T R O D U C T O R Y D A I R Y S C I E N C E . Fall term . C red it three hours Pre­ requisite, C hem istry 102 or 106. L ectures, T T h 11. Stocking 218. L a b o ra to ry T °r ^ Stocking 209. Professor J. C. W h i t e and assistants. The scientific and practical aspects of milk and a survey of the dairy industry. E special atte n tio n is given to the com position of m ilk an d its physical an d chem ical properties, quantitative tests for fa t and other constituents. S. B I O C H E M I C A L C O N T R O L O F D A I R Y P R O D U C T S . S p rin g term . C re d it tw o hours. P rerequisite, course 1. L ec tu re , F 11. L ab o ra to ry p ra ctic e , F 1-4. Stocking 119. Associate Professor K r u k o v s k y . T he chem ical analysis of milk and dairy products, and the biochem ical changes m these products th at cause undesirable flavors and other changes. 22. M A R K E T M I L K . Spring term . C redit three hours. Prerequisite, course 1 a n d B acteriology 1 or 3. N o t o p en to d airy m ajo rs. L ectu res, M W 10. R e citatio n W 2. Stocking 119. Professor H o l l a n d . T he scientific, technical, and sanitary aspects of the fluid m ilk industry. *30. D A I R Y P L A N T E Q U I P M E N T . Fall term . C redit three hours. For oneyear stu d en ts in d airy industry. L ectures, T 9, W 2. S tocking 120. L a b o ra to ry T 10-12 or W 3-5. A ssistant Professor M a r c h . A study of dairy-plant equipm ent and the fundam entals of heat, power and re­ frigeration as applied to this equipm ent. *31. E L E M E N T A R Y D A I R Y I N D U S T R Y . Fall term . C redit four hours For one-year stu d en ts in d airy industry. L ectures, M W F 10. Stocking 119. L ab o ra to ry Th 8-11. Stocking 209. Assistant Professor M a r c h . The composition and analysis of milk and milk products. *32. P R O C E S S I N G O F M I L K A N D M I L K P R O D U C T S . Spring term . C redit five hours. F o r one-year stu d en ts in d a iry industry. L ectures, T T h 8. Stocking 119. Laboratory, T T h 9-1. Assistant Professor M a r c h . f™- * 9 ° urses 30>31>,32' 33. an d 34 will n o t be given unless a t least ten stu d en ts have been accented for the one-year curriculum in d airy m anufacturing a n d m arketing by June 1, 1953. T he processing and sanitary control of fluid milk, and the m anufacture of milk products. *33. D A I R Y M A T H E M A T I C S . Spring term . C redit two hours. For one-year stu­ dents in dairy industry. Lectures, M W 11. Stocking 119. Assistant Professor M a r c h . Elem entary m athem atics as applied in the m anufacture of dairy products. *34. T H E D A I R Y I N D U S T R Y . Spring term . C redit one hour. For freshmen an d one-year stu d en ts in d airy industry. L ec tu re , M 1. Stocking 120. A ssistant P ro ­ fessor M a r c h and guest speakers. 102. M A R K E T M I L K . S p rin g term . C re d it five hours. P rereq u isite, course 1, and Bacteriology 1 or its equivalent. L ectures, M W 10. L aboratory, M W 2-6. Stocking 119. Professor H o l l a n d and assistants. T he scientific, technical, and sanitary aspects of the fluid-milk industry. 103. M I L K - P R O D U C T S M A N U F A C T U R I N G . Fall term . C red it five hours. P rerequ isite, course 1, B acteriology 1, a n d o rganic chem istry. T T h 1 1 -4:30. Stock­ ing 120. Associate Professor K o s i k o w s k y and assistant. T he principles and practice of making butter, cheese, and casein, including a study of the physical, chem ical, a n d biological factors involved. C on sid eratio n is given also to com m ercial operations and dairy-plant m anagem ent. 104. M I L K - P R O D U C T S M A N U F A C T U R I N G . Spring term . C red it five hours. Prerequisite, course 102. T T h 11-4:30. Stocking 119. Assistant Professor J o r d a n and assistant. T he principles and practice of m aking condensed and evaporated milk, milk powders, ice cream , and by-products, including a study of the physical, chemical, and biological factors involved. 108. C O M M E R C I A L G R A D E S O F D A I R Y P R O D U C T S . Fall term . C redit one ho u r. Should be p reced ed by course 1. H o u rs to be a rra n g e d . A ssistant Professor S hipe. T he classification of dairy products and the factors involved in grading them. 111. A N A L Y T I C A L M E T H O D S . Spring term . C redit four hours. Prerequisite, q u an titativ e analysis. L ectures, T T h 11. L aboratory practice, T 1-5. Stocking 120. Professor H e r r i n g t o n and assistant. A study of the more im portant operations and apparatus used in quantitative analysis, and their practical application. 113. C H E M I S T R Y O F M I L K . Fall term . C redit two hours. Prerequisite, quali­ tative a n d q u a n tita tiv e analysis a n d organic chem istry. L ectures, M W 8. Stocking 120. Professor H e r r i n g t o n . A consideration of milk from the physiochem ical point of view. D A IR Y B A C T E R IO L O G Y . (See Bacteriology.) 210. S P E C I A L T O P I C S I N D A I R Y C H E M I S T R Y . Fall term. C redit one hour. R egistration b y permission. Tim e to be arranged. Professor H e r r i n g t o n . T h e class undertakes, by cooperative effort, to prepare a com prehensive, w ritten review of some topic in the field of dairy chem istry. T h e subject for review is changed each term and graduate students may register indefinitely. [220. C H E M I S T R Y O F M I L K P R O D U C T S . Spring term . C redit four hours. Prerequisite, course 113. Professor — — —.] N o t given in 1953-54. An advanced consideration of the chem ical physical aspects of milk products. * Courses 30, 31, 32, 33, an d 34 will n o t be given unless a t least ten students have been accepted for the one-year curriculum in d airy m anufacturing an d m arketing by June 1, 1953. 251 R E S E A R C H . Fall or spring term . C redit one or m ore hours, by arrangem ent. For advanced students. Assistant Professor J o r d a n . Special problems in any phase of dairy work m ay be elected. 252. S E M I N A R . Fall and spring terms. T im e to be arranged. Stocking. Staff. D R A W IN G MECHANICAL 1. M E C H A N I C A L D R A W I N G . F a ll o r sprin g term . C re d it th ree h o u rs L ec­ tures, T T h 8. Stocking 119. L aboratory: fall term , W 1-5 or T h 1-5; spring term W 1-5. Stocking 410. L im ited to 24 students p e r laboratory. Book and supply lists are available a t the book*stores. M r. G r u b . A course dealing w ith graphic presentation. T he work includes lettering; use of instrum ents; orthographic projection involving plans, elevations, and sections; iso­ m etric draw ing; auxiliaries, and the practical applications of these principles to simple problems. 2. A D V A N C E D M E C H A N I C A L D R A W I N G . Fall term . C red it three hours. Prerequisite, course 1 or sufficient high school draw ing. L ectures, W F 8. Stocking 119. L aboratory, T h 1-5. Stocking 410. L im ited to 24 students p e r laboratory. Book and supply lists are available a t the book stores. M r. G r u b . A continuation of course 1 w ith work on m achine draw ing, including assembly draw ings; intersections; developm ents; descriptive geom etry; sectional and auxil­ iary views; and the use of conventional symbols. FREEHAND 10. D R A W I N G F O R L A N D S C A P E S T U D E N T S . T h r o u g h o u t th e year. C re d it two hours a term . F irst term , W F 1 :4 0 -4 :3 0 ; second term , M F 11-1 and S 9-11. M ann 500. Assistant Professor B u rc k m y e r. A course planned to develop (1) practical ability in the sketching of outdoor plantings and landscaping; (2) facility in lettering, in isom etric and perspective draw ing, and in m ethods of rendering perspective drawings from landscape plans. 11. F R E E H A N D D R A W I N G . Fall or spring term . C re d it from two to four hours. Three hours of practice required for each hour of credit. H ours to be ar­ ranged in any of the following periods: M T W T h F 9-12, T 2-4. M ann 500. As­ sistant Professor B u rc k m y e r. T he object of this course is to develop accuracy of observation and skill in delin­ eation. P ractice is given in the application of freehand perspective; o utdoor sketch­ in g ; the draw in g of in te rio r scenes, figures, a n d subjects w ith in each stu d e n t’s special field of interest. T h e course is plan n ed for beginning students as an aid in teaching nature study, biological sciences, and home economics and for those who need help in illustrating. 16. S P E C I A L P R O B L E M S F O R A D V A N C E D S T U D E N T S . F all o r sp rin g term. C redit two or three hours. T hree hours of practice required for each hour of c red it. P rereq u isite, course 11 o r its e quivalent. H o u rs to be a rra n g e d . M a n n 500. Assistant Professor B u rc k m y e r. For students who wish to attain proficiency in some particular type of illustration or technique. 17. S C I E N T I F I C I L L U S I R A T I N G . S p rin g term . C re d it tw o h o u rs. P re re q u i­ site, course 11 o r perm ission of the in stru cto r. Six hours of lab o ra to ry to be a rra n g e d by appointm ent w ith the instructor. M ann 5 00. Assistant Professor B u rc k m y e r . T his course surveys illustration m ethods suitable for application in a variety of scientific fields and gives training in several techniques ,such as pen and ink, scratch board, charcoal dust, stipple board, w ater color, and com binations of these. For prom oting accuracy and speed, instruction is given in the use of cam era lucida and o ther projection aids. M ethods of reproducing illustrations are studied w ith rela­ tion to cost and problems of publication. ENTOMOLOGY AND LIMNOLOGY For related work see the courses listed u n d er the heading “ C onservation” in this A n n o u n c e m e n t , a n d u n d e r “ Zoology” in th e A n n o u n c e m e n t of the College of Arts a n d Sciences. B IO L O G Y 1. G E N E R A L B I O L O G Y . F a ll a n d sp rin g term s. C re d it th ree ho u rs a term . T he course may be started in either term . N ot open to students who have had both Zoology 104 a n d B otany 1. If Biology 1 is tak e n a fte r e ith e r Zoology 104 or B otany 1, c re d it tw o hours a term . L ectures a n d d e m o n stra tio n , M W 9 or 11. R oberts 392. O ne laboratory a week, M T W T h or F 2-4 :30 or T 10-12:20. R oberts 301 and 302. Professor H o o d and assistants. An elem entary course planned to m eet the needs of students m ajoring outside of the p lan t and anim al sciences; particultrly adapted as the first year of a two-year sequence in biology for the prospective teacher of general science in the secondary schools. T he course deals w ith the n atu re of life, life processes, the activities and origin of living things. I t covers the organization of representative plants and ani­ mals, including m an as an organism, and the principles of nutrition, grow th, be­ havior, reproduction, heredity, and evolution. 5. L A B O R A T O R Y M E T H O D S I N B I O L O G Y . F all term . C re d it th ree hours. P rerequisite, Biology 1, B otany 1, o r Zoology 102 o r 104. L ectu re a n d laboratory, T or F 10-12:30, and additional periods by appointm ent. Roberts 306. Assistant Professor U h l e r . For students w ho intend to teach or to follow some phase of biology as a profes­ sion. Subjects covered: collection, preservation, and storage of m aterials; the prep­ aration of bird and m am m al skins for study; injection of blood vessels and em balm ­ ing; clearing and staining of small veretbrates; protozoological m ethods; and the preparation and staining of smears, whole m ounts, and sectional m aterials. 9. B I O L O G I C A L B A S I S O F S O C I A L P R O B L E M S . Spring term . C redit three hours. N o t to be tak en as a su b stitu te for, or a fte r, Biology 1. N o p rerequisites. Lectures and dem onstration, T T h S 9. R oberts 392. Assistant Professor U h l e r . An elem entary course designed especially to furnish a background in biological science for students in the College of H om e Econom ics who intend to enter the field of nursery-school teaching, though open to other interested students as well. A sur­ vey course of biological principles, w ith emphasis on hum an structure, developm ent, heredity, and eugenics. GENERAL ENTOMOLOGY Students are accepted as m ajors in entomology only upon the consent of the head of the D epartm ent or of a m em ber of the staff designated to act for him. Except in certain fields, this will norm ally be done only at the end of the sophomore year. C ertain prescribed courses are required, and a high scholastic average is ex­ pected. 12. G E N E R A L E N T O M O L O G Y . F a ll term . C re d it th ree hours. L ectu res, W F 11. Com stock 245. L aboratory, W T h or F 2 -4 :3 0 or S 10:30-1. Com stock 300. P ro fe ss o r---------- a n d assistants. A survey of the structure, biology, and classification of insects, w ith laboratory exercises on, and dem onstrations of, their anatom y and biology, and practice in the identification of representative forms. 16. I N S E C T E C O L O G Y . Fall term . C red it three hours. Prerequisite, Biology 1 o r Zoology 102 o r 104, a n d course 12 or 42. L ectu res, T T h 11. C om stock 245. L aboratory and field work, T h 2-4:30. Professor P a lm . A study of insects in relation to their environm ent, w ith special attention given to the applied aspects of insect ecology. Field and laboratory work provides an op­ portunity for color photography w ith insects. 118. T E C H N I C S O F B I O L O G I C A L L I T E R A T U R E . F all term . C red it two hours. G it'en in alternate years. Lectures, T T h 9. Com stock 300. A ssistant Professor F ran c le m o n t. History of the developm ent of entomological literature and a critical study of the biologists’ works of reference. Practice in the use of indices and bibliographies, and practice in the preparation of the latter. INSECT M ORPHOLOGY 122. I N S E C T M O R P H O L O G Y , A N A T O M Y , A N D H I S T O L O G Y . Fall and spring term s. C re d it th ree hours a term . P rereq u isite, course 12 o r 42. L e c tu re , T 10. Com stock 145. Laboratory, M W 2-4:30. Com stock 270. Associate Professor B u tt. A study of external and internal anatom y of insects. Laboratories include gross dissection and histological studies of internal organs of representative insects. 123. I N S E C T E M B R Y O L O G Y A N D P O S T E M B R Y O N I C D E V E L O P M E N T . Spring term . C red it tw o hours. Prerequisite, courses 12 or 42 an d 122. H o urs by a r­ rangem ent. Associate Professor B u t t . Lectures w ith assigned reading and reports by students. 124. I N S E C T H I S T O L O G Y : T E C H N I Q U E . Fall o r spring term . C red it two hours. P rereq u isite, courses 12 o r 42 a n d 122. T w o lab o ra to rie s a w eek by a p p o in t­ m ent. Com stock 265. Associate Professor B u t t . T he technique of preparing, sectioning, and m ounting insect tissues for study. INSECT TAXONOM Y 30. I N T R O D U C T O R Y I N S E C T T A X O N O M Y . Spring term . C redit three hours. P rereq u isite, course 12 o r 42. L ec tu re T h 10. C om stock 300. L ab o ra to ry , T T h 2-4:30. Comstock 300. Assistant Professor E v a n s . An introduction to the classification, nom enclature, and distribution of insects. L aboratory practice in the identification of orders, families, and representative genera of insects; m ethods of collection and preparation of insect specimens. Field trips are taken in the late spring. 131. T A X O N O M Y OF INSECTS EXCLUSIVE O F T H E L A R G E R OR D E R S O F H O L O M E T A B O L A . Fall term . C redit four hours. Prerequisite, course 30. G iven in altern ate years. L ectures, W F 10. L aboratories, W F 2-4 :3 0 . Com stock 300. Assistant Professor E v a n s . Lectures on the classification, bionomics, and evolution of the orders and families of insects, exclusive of the larger orders of H olom etabola. Laboratory studies on the literature and on the characters and classification of representative genera and species. C o n tin u a tio n of taxonom y of H o lo m eta b o la is in courses 132, 133, a n d 134. [132. T A X O N O M Y O F T H E I M M A T U R E S T A G E S O F H O L O M E T A B O L A . Fall term . C redit three hours. Prerequisite, course 30. Assistant Professors E v a n s and F r a n c l e m o n t .] N ot given in 1953-54. Lectures on the structure and habits of insect larvae. L aboratory studies of the literature, com parative m orphology, and identification of the im m ature stages of the Holometabola. 133. T A X O N O M Y O F T H E H O L O M E T A B O L A : C O L E O P T E R A A N D DIP- T E R A . Spring term. C redit three hours. Prerequisite, course 30. Given in alternate years. L ecture, W 10. L aboratory, W F 2-4:30. Com stock 300. A ssistant Professors E v an s and F ra n c le m o n t. Lectures on the classification, bionomics, and evolution of the C oleoptera and D iptera. L aboratory studies on the literature and on the characters and classification of representative genera and species of these orders. [134. T A X O N O M Y O F T H E H O L O M E T A B O L A : L E P I D O P T E R A A N D H Y M E N O P T E R A . Spring term . C redit three hours. Prerequisite, course 30. Assist­ an t Professors F r a n c l e m o n t and E v a n s .] N ot given in 1953-54. L ectures on the classification, bionomics, and evolution of the L epidoptera and H ym enoptera. L aboratory studies on the literature and on the characters and clas­ sification of representative genera and species of these orders. [235. P R O C E D U R E S I N T A X O N O M Y . Fall term . C redit one hour. Prerequi­ site, course 30. Assistant Professor F r a n c l e m o n t ] N ot given in 1953-54. A study of zoological nom enclature; the preparation of taxonom ic papers, includ­ ing descriptions, keys, and illustrations; m ethods of analyzing taxonom ic data. ECONO M IC ENTOM OLOGY 41. G E N E R A L E C O N O M I C E N T O M O L O G Y . Fall term . C redit three hours. Prerequisite, course 12'o r 42. Lectures, T T h 9. Com stock 145. Laboratory, T W 2-4:30. Comstock 100. Professor W a t k i n s and assistants. L ectures on the life histories and habits of insects injurious to the m ajor plant and anim al crops of the U nited States, and on m ethods used in their control; lab­ oratory exercises on the com m oner pests and m ore im p o rtan t insecticides. T his course is designed for those students who have h a d previous work in entom ology and for those who plan to m ajor in the D epartm ent. 42. E L E M E N T A R Y E C O N O M I C E N T O M O L O G Y . Spring term . C redit three hours. T his course is designed prim arily for students w ho wish to take econom ic entomology but do not plan to take any other courses in the D epartm ent. N ot open to graduate students for credit. Lectures, T T h 9. Com stock 2 4 5 . Laboratory, M T W T h or F 2 -4 :3 0 . Comstock 100. Professor W a t k i n s and assistants. Lectures on the economic im portance of insects, position of insects in the anim al kingdom , the orders of m ajor im portance, principles of insect control, life histories and habits of selected insects attacking plant and anim al crops in New York. Lab­ oratory exercises on life histories, recognition, and control of the com m oner insects of New York. [241. S P E C I A L T O P I C S I N E C O N O M I C E N T O M O L O G Y . Fall term . C redit three hours. G iven in alternate years. Prerequisite, course 41 or permission to reg­ ister. Professor S c h w a r d t and Associate Professor G y r is c o .] N ot given in 1953-54. A course for graduate and advanced undergraduate students dealing w ith funda­ m ental principles of insect control, w ith discussion of some of the m ajor problems in agricultural entomology. Topics covered: insect pests of livestcok and of stored grain and forage crops. [242. S P E C I A L T O P I C S I N E C O N O M I C E N T O M O L O G Y . Spring term . C redit three hours. Given in alternate years. Prerequisite, course 41 or permission to register. Associate Professors B r a n n and D e w e y .] N ot given in 1953-54. A continuation of course 241. Topics treated: insecticide application equip­ m ent; and insect pests of fruit. 243. S P E C I A L T O P I C S I N E C O N O M I C E N T O M O L O G Y . Fall term . C redit three hours. Given in alternate years. Prerequisite, course 41 or permission to reg­ ister. L ectures, M W 11. Com stock 145. L aboratory, F 11-1. Com stock 100. Pro­ fessors R a w l i n s and W a t k i n s . A continuation of courses 241 and 242. Topics covered; biological control; legislative entom ology; and insect pests of vegetable crops. 244. S P E C I A L T O P I C S I N E C O N O M I C E N T O M O L O G Y . Spring term . C red it three hours. Given in altern ate years. Prerequisite, course 41 or perm ission to register. L ectures, M W 11. Com stock 145. L aboratory, F 11-1. Com stock 100. P ro fe s s o r----------- a n d A ssociate Professor M a t t h y s s e . A continuation of courses 241, 242, and 243. Topics covered: insect pests of woody ornam entals, forests, and tu rf; and insect pests of comm ercial florist crops and herbaceous ornamentals. PA RASITOLOG Y AND M EDICA L EN TO M O LO G Y 151. P A R A S I T O L O G Y . Spring term . C redit three hours. Given in alternate years. Prerequisite, Biology 1 or Zoology 102 or 104. C ourse 12 is also recom ­ m ended. Lecture, T h 9. Comstock 245. Laboratory, T h 2-4:30 and S 10:30-1. Comstock 200. Professor T r a v is . A study of the principal protozoan and helm inth parasites of m an and other vertebrates, w ith special emphasis given to life histories and recognition. [152. M E D I C A L E N T O M O L O G Y . Fall term . C redit three hours. G iven in a lte rn a te years. P rerequisite, Biology 1 o r Z oology 102 o r 104. C ourse 12 is re c ­ om mended. Professor T r a v is .] N ot given in 1953-54. A study of insects and other arthropods th at are the causative agents of disaese in m an and other animals, or are the vectors, or are the interm ediate hosts of disease-producing organisms. L aboratory studies stress life histories and recognition. 153. P A R A S I T O L O G Y T E C H N I Q U E S . Spring term . C redit two hours. Given in altern ate years. Prerequisite, course 151 or m ay be taken concurrently w ith course 151. Prim arily for graduate students. U ndergraduates by permission. Lec­ ture, F 9. Comstock 200. Laboratory, F 2-4:30. Com stock 200. Professor T r a v is . A laboratory study of the techniques used by research and practical workers in the field of parasitology. [154. W I L D L I F E P A R A S I T O L O G Y . Fall term . C redit two hours. Given in a l­ ternate years. For qualified graduate and undergraduate students w ith a special interest in the parasites of wildlife. Prerequisite, permission to register. Professor T r a v is .] N ot given in 1953-54. A technical course w hich stresses the life histories and recognition of parasites associated w ith wildlife species. [155. M E D I C A L E N T O M O L O G Y T E C H N I Q U E S . Fall term . C red it two hours. Given in alternate years. Prerequisite, course 152 or m ay be taken w ith it. Prim arily for graduate students. U ndergraduate students by permission. Professor T r a v is .] N ot given in 1953-54. A laboratory study of the techniques used by research and practical workers in the field of m edical entomology. A PICU LTU RE A dvanced and graduate students taking courses 122 and 125 and specializing in apiculture are perm itted to use the honeybee as illustrative m aterial in the laboratory work of these courses. 61. I N T R O D U C T O R Y B E E K E E P I N G . Spring term . C redit two hours. Lec­ tures, T T h 11. Com stock 245. Professor D y c e . This course is intended to afford a general knowledge of the fundamentals of beekeeping, including the life history, instincts, and general behavior of honeybees. Special attention is given to the role of bees in the cross-pollination of agricultural crops, as well as production of honey and beeswax. 261. A D V A N C E D B E E K E E P I N G . Throughout the year. Credit three hours a term. Given in alternate years. Prerequisite, courses 12 and 61 and previous bee­ keeping experience. Lectures and laboratory. T Th 2-4:30. Comstock 17. Profes­ sor D y c e and Assistant Professor C o g g s h a l l . An advanced course for those specializing in apiculture. Considerable time is devoted to a study of the entire field of beekeeping. Laboratory work covers bee behavoir, external and internal anatomy, disease diagnosis, honey and beeswax production, and preparation for market, and the management of colonies for pol­ lination service. [262. S P E C I A L T O P I C S I N B E E K E E P I N G . Throughout the year. Credit three hours a term. Given in alternate years. Registration by permission; open to qual­ ified juniors, seniors, and graduate students. By appointment. Professor D y c e and Associate Professor C o g g s h a l l . ] Not given in 1953-54. A technical course designed for advanced students, and covering scientific in­ vestigation in all phases of the subject. Special attention is given to improved methods of apiary and honey-house management and the preparation of honey for market. Current literature on beekeeping is assigned, reviewed, and evaluated by students. Lectures and discussions are supplemented by field trips. LIMNOLOGY 171. L I M N O L O G Y . Fall term. Credit three hours. Prerequisite, nine hours of biological science and a course in general physics and general chemistry. Lec­ ture, F 10. Comstock 145. Laboratory and field trips, F 2-4:30 and S 8-10:30. Comstock 110. Associate Professor---------. The ecology of streams, lakes, and ponds, and conditions that determine their productivity. 172. A D V A N C E D L I M N O L O G Y . Spring term. Credit three hours. Prereq­ uisite, course 171 and permission to register. Lecture, Th 11. Comstock 145. Lab­ oratory and field trips, F 2-4:30 and S morning by arrangement. Comstock 110. Associate Professor---------. A quantitative treatment of the problem of the productivity of inland waters. F I S H E R Y B I O L O G Y A N D F I S H C U L T U R E . See full description under “Conservation.” INSECT PHYSIOLOGY 185. I N S E C T P H Y S I O L O G Y . Fall term. Credit five hours. Given in alternate years. Prerequisite, course 122, Chemistry 106, and Physics 104 or 108. Lectures, M W F 9. Comstock 145. Laboratory, M W 2-4:30. Comstock 265. Professor P a tto n . An introductory course for upperclassmen and graduate students. The physiol­ ogy of insect systems is discussed and demonstrated by a series of laboratory ex­ ercises. INSECT TOXICOLOGY [195. C H E M I S T R Y A N D T O X I C O L O G Y O F I N S E C T I C I D E S . Fall term. Credit six hours. Given in alternate years. Prerequisites, general chemistry and organic chemistry. Primarily for graduate students. Undergraduate students by permission. Professor N o r t o n and Associate Professor D e w e y .] Not given in 1953-54. The fundamental chemical and physical properties of insecticides and the prin­ ciples of evaluating their effects on insects. RESEARCH 300-310. R E S E A R C H . Fall and spring terms. Credit and laboratory fees to be arranged. Prerequisite, permission to register from the professor under whom the work is to be taken. Comstock or Roberts. 300. I N S E C T E C O L O G Y . Professor P a l m . 301. I N S E C T M O R P H O L O G Y , H I S T O L O G Y , A N D E M B R Y O L O G Y . As­ sociate Professor Butt. 302. T A X O N O M Y . Professor H o o d , Associate Professor D i e t r i c h , and--------- , and Assistant Professors Evans and Franclemont. 303. E C O N O M I C E N T O M O L O G Y . Professors P a l m , S c h w a r d t , L e i b y , R a w ­ l i n s , and W a t k i n s ; Associate Professors B r a n n , D e w e y , M a t t h y s s e , G y r i s c o , and L a P l a n t e . 304. M E D I C A L E N T O M O L O G Y A N D P A R A S I T O L O G Y . Professor T r a v i s . 3 0 5 . A P I C U L T U R E . Professor D y c e and Associate Professor C o g g s h a l l . 306. L I M N O L O G Y . Associate Professor --------- . 307. I N S E C T P H Y S I O L O G Y . Professor P a t t o n . 308. I N S E C T T O X I C O L O G Y . Associate Professor D e w e y . 309. I N S E C T I C I D A L C H E M I S T R Y . Professor N o r t o n . 310. B I O L O G Y . Professor Hood and Associate Professor U hler. SEMINAR J U G A T A E . Fall and spring terms. M 4:30-5:30. Comstock 245. The work of an entomological seminar is conducted by the Jugatae, an ento­ mological club that meets for a discussion of the results of investigations by its members. EXTENSION TEACHING 1. O R A L A N D W R I T T E N E X P R E S S I O N . Throughout the year. Credit three hours a term. Primarily for students of the two-year courses. Lectures and practice: fall term, M W F 8 or 11 or T Th S 10; spring term, M W F 8, 9, or 11. Warren 131. Criticism, by appointment, daily 8-5 and S 8-1. Associate Professor F r e e m a n , Assistant Professor M a r t i n , and Messrs. L u e d e r a n d ---------. Practice in oral and written presentation of topics in agriculture, with criticism and individual appointments on the technique of public speech. Designed to en­ courage interest in public affairs, and, through demonstrations and the use of graphic materials and other forms, to train for effective self-expression in public. Special training is given to competitors for the Eastman Prizes for Public Speaking and the Rice Debate Stage. In addition, some study is made of representative work in English literature. Part of the work in the second term is a study of parliamentary practice. 101. O R A L A N D W R I T T E N E X P R E S S I O N . Fall or spring term. Credit two hours. Open to juniors and seniors. The number in each section is limited to twenty students. Lectures and practice: fall term, M W 9, T Th 9, 10, or 11, W F 10, Roberts 131; spring term, M W 9, T Th 9 or 11, Warren 131. Criticism, by appointment, daily 8-5, S 8-1. Professor P e a b o d y , Associate Professor F r e e ­ m a n , Assistant Professor M a r t i n , and M r . L u e d e r . Practice in oral and written presentation of topics in agriculture, with criticism and individual appointments on the technique of public speech. Designed to en­ courage interest in public affairs, and, through demonstrations and the use of graphic material and other forms, to train for effective self-expression in public. Special training is given to competitors for the Eastman Prizes for Public Speak­ ing and in the Rice Debate contest. (See page 106.) 102. O R A L A N D W R I T T E N E X P R E S S I O N . Spring term. Credit two hours. Prerequisite, course 101, of which course 102 is a continuation. Lectures and prac­ tice, T Th 10 or W F 10. Warren 131. Criticism, by appointment, daily 8-5, S 8-1. Professor P e a b o d y and Associate Professor F r e e m a n . A part of the work of the course consists of a study of parliamentary practice. 104. A D V A N C E D O R A L E X P R E S S I O N . Spring term. Credit two hours. Pre­ requisite, courses 101 and 102 and the permission of the instructor. Limited to nine students. M W 12. Warren 31. Professor P e a b o d y . An advanced course of study and practice in oral expression as directly related to the needs of the county agricultural agent, the home demonstration agent, the 4-H Club agent, and the extension specialist. JOURNALISM 15. A G R I C U L T U R A L A N D H O M E E C O N O M I C S J O U R N A L I S M . Fall or spring term. Credit three hours. M W F 10. Warren 231. Professor W a r d . An introductory course dealing with the farm press, daily and weekly news­ papers, magazines, trade journals, book publishing, advertising, radio, television, and other fields related to agricultural and home economics journalism. The opera­ tions of the major mediums of communication and the techniques of writing for each are studied. 1 1 0 . N E W S W R I T I N G . Spring term. Credit two hours. Prerequisite, course 15. Th 2 -4 . Warren 2 3 2 . Associate Professor K n a p p . Primarily the writing of agricultural and home-economics news for publication. The course includes criticisms, discussions, and consultations on published material written by students. [112. A G R I C U L T U R A L A D V E R T I S I N G A N D P R O M O T I O N . Spring term. Credit two hours. Open to juniors and seniors, and to other students by permis­ sion of the instructor. Professor W a r d and guest lecturers from advertising agen­ cies.] Not given in 1953-54. The use of commercial advertising and sales promotion methods and media in promoting the sale of products and new or improved farm and home practices and programs. Includes market analysis, planning of the advertising and/or pro­ motion units, selection of media, preparation of copy, and sales-promotion pieces. 113. W R I T I N G F O R M A G A Z I N E S . Spring term. Credit two hours. Not open to freshmen. M 2-4. Warren 260. Professor W a r d . A course dealing chiefly with the writing of fact articles for publication in ag­ ricultural, home economics, or general magazines. Students may write on any subjects they choose. The articles and publication markets are analyzed. RADIO 120. R A D I O B R O A D C A S T I N G . Spring term. Credit three hours. Not open to freshmen. M W F 9. Warren 145. Associate Professor K a i s e r , Mr. R i c h a r d s , and Mrs. G a b r i e l . An introductory course to familiarize students, particularly those in agriculture and home economics, with the best methods of presenting ideas by radio and with radio-studio procedure. Practice includes auditions and criticisms for all members of the class in preparing and presenting radio talks; continuity writing and program arrangements. 121. FARM AND HOME RADIO PRODUCTION AND PROGRAMMING. Fall term. Credit two hours. Prerequisite, course 120 or permission of the instructor. T 2-4. WHCU Campus Studio. Associate Professor Kaiser and staff. A comprehensive course in farm and home radio wiring, program planning, and presentation. The course covers the actual gathering and correlating of material, transcribing, and discussion of results. Students are assigned regular program prob­ lems which they will carry through to completion. Field work is handled with wire and tape recorders. A television seminar is to be arranged. VISUAL AIDS 130. PHOTOGRAPHY. Spring term. Credit two hours. Lectures and laboratory, S 9-12. Roberts 492. Open to juniors, seniors, and graduate students. Limited to twenty-five students. Registration by permission only. Primarily intended for those who plan to enter fields of agriculture and home economics in which a knowledge of photographic principles is important. Associate Professor E. S. P h i l l i p s and Messrs. M a u r e r and K r u s e . A course that deals with the techniques of photography to be used in news­ papers, magazines, bulletins, and for film strips, motion pictures, and other media. 131. VISUAL AIDS: THEIR SCOPE, PREPARATION, AND USE. Fall term. Credit two hours. Lecture and demonstration, S 9-11. Roberts 392. Open to juniors, seniors, and graduate students. Associate Professor E. S. P h i l l i p s and departmental staff. A course designed to familiarize the student with the forms, purposes, prepara­ tion, and use of all types of visual aids (slide sets, motion and news photography, exhibits, posters, and other media), useful to teaching, promotion, or public-relations problems in agriculture and home economics. Includes practice in selection of and planning specifically assigned problems. EXTENSION ORGANIZATION AND METHODS 140. EXTENSION ORGANIZATION, ADMINISTRATION, AND POLICY. Spring term. Credit three hours. Open to graduate students and seniors, and to juniors by special arrangement. Students who have not been following the cur­ riculum for extension workers should consult the instructor before registering. Lectures and exercises based on current extension work. M W F 11. Roberts 492. Professor K e l s e y and others. This course is designed to familiarize students with the organization, admin­ istration, methods, and policies of extension work as exemplified in New York State. It is for students interested in voluntary leadership in extension as well as for prospective tension workers cionunatgyriacuglrtiucurelt.ur(aSleeagaelnsots,Hcoomunemtyak4-inHg Club agents, or other Education courses in ex­ the College of Home Economics.) FLORICULTURE AND ORNAMENTAL HORTICULTURE Instruction in the Department of Floriculture and Ornamental Horticulture is planned for students with the following interests: ( 1) commercial plant production, distribution, or utilization, including the management of greenhouses, nurseries, and wholesale and retail establishments; (2 ) developing a landscape service, in­ cluding the planning, construction, planting, and maintenance of small properties (these students are expected to register for one summer session) ; (3) superintend- ence of parks, golf courses, cemeteries, or of private estates; (4) the culture and use of ornamental plants in the home garden and in the home. Special curricula are set up to meet the needs of those students desiring training in the above fields. Undergraduate students may plan their course as preparation for graduate train­ ing leading to university teaching, or research positions with universities, experiment stations, or industry. ... Courses 1, 2, 10, 12, 13, 115, and 123 are required of all students majoring in the Department. These students must also satisfy the Department practice require­ ment based on experience wth ornamental plants and their culture. GENERAL COURSES 1. G E N E R A L F L O R I C U L T U R E A N D O R N A M E N T A L H O R T I C U L T U R E . Fall term. Credit three hours. Lectures, M W 10. Plant Science 37. Laboratory, T W or Th 2-4. Plant Science 15. Professor M a c D a n i e l s and Mr. . An elementary course covering the principles and practices of growing ornamental plants in the garden, greenhouse, and home. 2. I N T R O D U C T I O N T O L A N D S C A P E D E S I G N . Spring term. Credit three hours. Lectures, M W F 9. Plant Science 233. Associate Professor P o r t e r . A consideration of the principles of landscape design as applied to the small- residence property. 5. F L O W E R A R R A N G E M E N T . Fall or spring term. Credit two hours. Fall term: lecture, M 10, Plant Science 141; laboratory, M 2-4:30, T o r W 10-12:30, Plant Science 22. Mrs. Fox. Spring term: lecture, T 10, Plant Science 37; labora­ tory, T or W 2-4:30 or Th 10-12:30, Plant Science 22. Mr. Fox. A study of the principles and methods of arranging flowers and other plant ma­ terials for decorative use in the home and for exhibition. PLANT MATERIALS 10. T A X O N O M Y O F C U L T I V A T E D P L A N T S . Fall term. Credit four hours. Intended primarily for students majoring in floriculture. Prerequisite, Botany 1 or its equivalent. Lectures, W F 11. Plant Science 37. Laboratory, T Th or W F 2-4:30. Plant Science 22. Mr. D r e s s and Assistant Professor L e e . A study of the kinds of cultivated ferns and seed plants and their classification into families and genera. Emphasis is placed on methods of identification, the prep­ aration and use of the analytical keys, the distinguishing characteristics of the fam­ ilies concerned and their importance in ornamental horticulture. 12. H E R B A C E O U S P L A N T M A T E R I A L S . Spring term. Credit three hours. Prerequisite, course 10 or permission to register. Should be followed by summer session course in Herbaceous Plant Materials. Lectures, T Th 8. Plant Science 37. Laboratory, W 10-12:30 or 2-4:30. Plant Science 15. Assistant Professor L e e . A study of the ornamental herbaceous plants used in landscape and garden plant­ ings. Emphasis is placed on the identification, use, and culture of^spring-flowering bulbs and perennials. The class visits Rochester parks and gardens in late May. 13. W O O D Y - P L A N T M A T E R I A L S . Spring term. Credit four hours. Prereq­ uisite course 10 or permission to register. Lectures, T Th 9. Plant Science 37. Lab­ oratory and field trips, M and W or F 2-4:30. Plant Science 29. Associate Professor CORNMAN. A study of the trees, shrubs, and vines used in landscape planting. Emphasis is planed on their characteristics and values for use as landscape material. The class visits Rochester parks and gardens. [113. W O O D Y P L A N T M A T E R I A L S , A D V A N C E D C O U R S E . Fall term. Credit two hours. Prerequisite, course 13. Associate Professor C o r n m a n .1 Not given in 1953-54. A course dealing with the important groups of landscape materials and the litera­ ture of the subject. A knowledge of the ordinary woody plants for landscape use in the Northeast is presumed. Emphasis is on less-known northern plants and upon plant groups basic in landscape design in other regions of the United States. Oppor­ tunities for practice in the determination of unknowns and in the use of the literature are provided. A trip is taken to the Rochester parks. NURSERY MANAGEMENT 114. T U R F . Spring term. Credit two hours. Given in alternate years. Prerequisite, Agronomy 1 and permission to register. Lecture, W 11. Plant Science 143. Laboratory, Th 2-4:30. Plant Science 29. Associate Professor C o r n m a n . A course dealing chiefly with the principles, practices, and materials for the con­ struction and maintenance of lawn areas. Some attention is given sports turf. A week-end inspection trip is taken to experimental test plots and special turf areas. 115. P L A N T P R O P A G A T I O N . Fall term. Credit three hours. Prerequisite, courses 12 and 13 and Botany 31 or the equivalent, or permission of the instructor. Lectures, T Th 8. Plant Science 37. Laboratory, Th 2-4:30. Greenhouses and nurseries. Associate Professor S n y d e r . A study of the principles and methods involved in the propagation of woody and herbaceous plants by seeds, division, layers, cuttings, budding, and grafting. The class visits nurseries at Geneva and Newark, New York. 117. C O M M E R C I A L N U R S E R Y M A N A G E M E N T . Spring term. Credit three hours. Prerequisite, course 115. Lectures, T F 11. Plant Science 37. Laboratory, T 2-4:30. Greenhouses and nurseries. Associate Professor P r i d h a m . A course supplementary to 115 dealing with the problems of the commercial propagation and growing of nursery plants. Pruning, digging, storage, and packag­ ing of nursery stock are considered. Trips are made to near-by commercial nurseries. 119. P L A N T I N G A N D M A I N T E N A N C E O F O R N A M E N T A L P L A N T S . Fall term. Credit three hours. Prerequisite, course 115. Lectures, T Th 11. Plant Science 37. Laboratory, W 2-4:30. Greenhouse, nurseries, and Cornell Plantations. Associ­ ate Professor P r i d h a m . A study of the principles and practices employed in the maintenance of orna­ mental plants, including soil relationships, planting, watering, cultivation, pruning, and winter protection of landscape plant materials in garden and park planting. Both woody and herbaceous materials are considered. Field problems and observa­ tional trips are conducted. COMMERCIAL FLORICULTURE 123. F L O R I S T C R O P P R O D U C T I O N . Fall term. Credit four hours. Prereq­ uisite, course 115, Botany 31, Agronomy 1, and the practice requirement. Lectures and recitations, M W F 9. Plant Science 37. Laboratory, M 2-4:30. Greenhouses. Professor P o s t . A comprehensive study of the application of basic science to the culture of orna­ mental plants, particularly under greenhouse conditions. A trip is taken to green­ houses in Rome and Utica, New York. 124. C O M M E R C I A L G R E E N H O U S E P R O D U C T I O N . Spring term. Credit three hours. Prerequisite, course 123. Lectures, M W 9. Plant Science 37. Labora­ tory, W 2-4:30. Greenhouses. Assistant Professor A n d r e a s e n . A course supplementary to course 123 dealing with the commercial production of florist crops; emphasis is upon the practical problems concerned. Several trips are made to near-by commercial greenhouses. 125. F L O W E R - S T O R E M A N A G E M E N T . Spring term. Credit two hours. Pre­ requisite, course 5 and permission to register. Lecture, W 11. Plant Science 37. Lab­ oratory, M 2-4:30. Plant Science 22. Mrs. Fox. Lectures devoted to flower-shop management, business methods, merchandising, and marketing of floricultural commodities. Laboratories to include the application of subject matter and the principles of commercial floral arrangement and design. A trip made to New York City includes the flower shops, retail florist establishments, and the New York Flower Market. LANDSCAPE SERVICE Students specializing in landscape service are expected to complete the course in planting design regularly given in the summer session. 32. E L E M E N T A R Y D E S I G N A N D P L A N T I N G O F S M A L L P R O P E R T I E S . Fall term. Credit three hours. Open to general election. Prerequisite, courses 2 and 13 and Drawing 10. Lecture, F 12. Laboratory, M F 2-4:30. Plant Science 433. Associate Professor P o r t e r . The application of the principles of design to the specific problems of the smallresidence property as related to both planning and planting. 132. L A N D S C A P E P L A N N I N G A N D P L A N T I N G O F S M A L L PROPERTIES. Fall and spring terms. Credit four hours a term. Intended for advanced students. Not open for general election. Prerequisite, courses 12 and 32. Lecture, T 12. Lab­ oratory: fall term, T Th 2-4:30 and three additional hours; spring term, W Th 2-4:30 and three additional hours. Plant Science 433. Associate Professor P o r t e r and Assistant Professor C a r e s . A study of the design and planting of small properties. 134. N U R S E R Y - L A N D S C A P E C O N S T R U C T I O N A N D E S T I M A T I N G . Fall term. Credit three hours. Intended for advanced students specializing in landscape service. Must be taken with course 132. Lecture, Th 9. Laboratory, M Th 10-12:30. Plant Science 433. Assistant Professor C a r e s . DEPARTMENTAL SEMINAR 241. S E M I N A R . For departmental staff and graduate students. Fall and spring terms. Time to be arranged. FOOD SCIENCE AND TECHNOLOGY A program of instruction has been arranged for students interested in the food industry. It combines courses in the sciences, various aspects of economics, food technology, and related subjects. A faculty adviser assists these students both in arranging their class schedules and in obtaining employment that will lead to ex­ perience appropriate to their objective and that may count toward the fulfillment of the practice requirement. Although Food Science and Technology is the name of a division in the New York State Agricultural Experiment Station at Geneva, it has not been applied to a teaching department in this College. Courses that might come logically under the heading of Food Science and Technology are found in a number of departments in the College of Agriculture or in other departments of the University. For ex­ ample, Principles of Food Preservation is course 130 in the Department of Biochem­ istry; courses in Bacteriology are found under the heading of Bacteriology; courses dealing with vegetables and fruits are found among the offerings, respectively, of the Departments of Vegetable Crops and Pomology; courses in the manufacture and processing of dairy products are listed under the Department of Dairy Industry; and courses in Chemistry are described in the A n n o u n c e m e n t of the College of A r t ’s a n d Sciences. 1. T H E F O O D I N D C S T R Y . Fall term. Credit three hours. For freshmen and sophomores; no credit for others. Lectures, M W F 10. Savage 145. A survey course to orient the student in the broad field of food processing. Lectures by various specialists on the staff cover the economic importance of the food industry and the relation of production and handling of the raw products to the quality of the processed foods. Emphasis is placed on the great variety of work and basic sci­ ence training involved in the production, processing, and distribution of quality foods. COURSES IN THE COLLEGE OF ENGINEERING OFFERED FOR NONENGINEERING STUDENTS1 E N G I N E E R I N G I N F O O D P R O C E S S I N G (E N G I N E E R I N G 3510). Fall term. Credit three hours. Prerequisite, college physics and chemistry. Primarily for stu­ dent in the College of Agriculture and School of Nutrition. Not open to engineering students. Lecture-recitations, T Th S 9. Warren 245. Professor E r d m a n . An introduction to engineering principles of construction and operation of me­ chanical and electrical equipment used in the preservation and storage of foods. [ E L E M E N T A R Y C H E M I C A L E N G I N E E R I N G (E N G I N E E R I N G 5110). Spring term. Credit three hours. Prerequisite, Engineering 3510. Primarily for stu­ dents in agriculture or nutrition. Not open to students in Chemical Engineering. Associate Professor W ie g a n d t .] Not given in 1953-54. A general discussion of the fundamental operations and processes of chemical engineering, with particular emphasis on their applications in the food-processing industries. Among the topics discussed are the unit operations of evaporation, filtra­ tion, agitation, distillation, and drying, and the general design of food-processing plants. METEOROLOGY I* B A S I C P R I N C I P L E S O F M E T E O R O L O G Y . Fall or spring term. Credit three hours. Prerequisite, Physics 103 or one year of high school physics. Lectures T Th 11. Plant Science 143. Laboratory, T W or Th 2-4:30. Plant Science lid! Simplified treatment of the physical processes of the atmosphere that produce commonly observed weather phenomena, followed by discussions of condensation and precipitation, winds, the general and secondary circulations, air masses, fronts, and elementary climatology and micro-climatology. In the laboratroy, emphasis is’ on common meteorological instruments and the weather map. The course is designed for those who wish a single survey course in meteorology. [2. G E N E R A L C L I M A T O L O G Y . Fall term. Credit two hours. Given in alternate years. Prerequisite, course 1.] Not given in 1953-54. A study of the factors producing the observed variations in climate, climatic types and their distribution over the earth, and the climate of North America and the United States. Emphasis is placed on the climate of New York State and on micro­ climatology as it applies to agriculture. [105. M E T H O D S I N C L I M A T O L O G Y . Fall term. Credit three hours. Given in alternate years. Prerequisite, course 2 or permission of the instructor.] Not given in 1953-54. Methods and limitations in the handling of climatic data. [106. M I C R O C L I M A T O L O G Y . Spring term. Credit three hours. Given in al­ ternate years. Prerequisite, course 1 or permission of the instructor.] Not given in 1953-54. A study of factors influencing climate in the atmospheric layer directly adjacent to the earth’s surface, and the variation of climate due to vegetation or small-scale topographic features. [211. R E S E A R C H . Fall or spring term. Credit one or more hours. Prerequisite, permission of the instructor.] Not given in 1953-54. A course designed for advanced and graduate students. Original investigations in meteorology and climatology. [212. S P E C I A L T O P I C S I N M E T E O R O L O G Y . Fall or spring term. Credit one or more hours. Prerequisite, permission of the instructor.] Not given in 1953-54. Study of meteorological topics more advanced than or different from those in other courses. Subject matter depends on the background and desires of those enrolling. PLANT BREEDING GENETICS 1. H E R E D I T Y A N D E U G E N I C S . Spring term. Credit two hours. (Students who have had course 101 are allowed one-hour credit.) Prerequisite, Zoology 104, Botany 1, or Biology 1. Lectures, W F 10. Discussion period, M 10, attendance vol­ untary. Plant Science 141. Assistant Professor E v e r e t t . An introduction to the laws of heredity, a survey of heritable characters in man, and discussions of the relationship between heredity in man and social problems. This course is intended primarily for students who have not previously had a college course in genetics and who wish to obtain a knowledge of principles of heredity, especially as applied to man. 101. G E N E T I C S . Fall term. Credit four hours. Prerequisite, a beginning course in biological science. Courses in cytology and in taxonomic botany and zoology are found helpful. Lectures, M W F 8. Plant Science 233. Laboratory, T 8-10, or M W Th or F 2-4. Plant Science 146. Assistant Professor E v e r e t t and assistants. A general study of the fundamental principles of genetics in plants and animals. Discussions of simple cases of inheritance, gene action and interaction, gene linkage, and the chromosome theory of heredity, inheritance of quantitative characters, in­ heritance of sex, effects of inbreeding and crossing, cytoplasmic inheritance, the origin of heritable variations and their relation to evolution. Laboratory studies of hybrid material in plants and breeding experiments with Drosophila. [201. B I O C H E M I C A L G E N E T I C S . Spring term. Credit two hours. Prerequisite, course 101 and a course in organic chemistry. Professor S r b .] Not given in 1953-54. The nature and function of hereditary units studied in terms of physiology and biochemistry. Students are expected to do extensive reading in the periodical litera­ ture of genetics and to prepare a term paper. 204. E X P E R I M E N T A L E V O L U T I O N . Spring term. Credit two hours. Prereq­ uisite, course 101 or the equivalent. Lectures, T Th 10. One discussion period, to b e arranged. Plant Science 141. Professor H. H. S m i th . A study of factors involved in the evolution of populations, races, and species. Topics covered include variability, polygenic inheritance, population dynamics, rates, changes in genetic systems, isolating mechanisms, and the evolution of certain economic plants. PLANT BREEDING 102. P L A N T B R E E D I N G . Fall term. Credit three hours. (Students who have had course 101 are allowed two hours credit.) Prerequisite, Botany 1. Lectures, T Th 8. Plant Science 141. Laboratory, S 8-10:30. Plant Science 146. Profes’sor M unger. A study of the principles and practices used in developing, evaluating, distrib­ uting, and maintaining improved crop varieties. Approximately one-third of the course is devoted to a study of elementary genetics. Designed primarily for students who wish a general knowledge of plant breeding. Students who expect to engage professionally in plant breeding should take courses 101 and 203 instead of this course. Lectures supplemented by periods in the greenhouse and experimental fields. A one-day field trip is taken. 203. M E T H O D S O F P L A N T B R E E D I N G . Fall term. Credit three hours. Pre­ requisite, course 101, Botany 1, and a course in at least one of the following: field crops, vegetable crops, floriculture, or pomology. Lectures, T Th 9. Plant Science 141. Laboratory, T 2-4:30. Plant Science 146. Professor M u r p h y . A course designed primarily for graduate students, but open to properly qualified seniors who expect to engage in plant breeding. A study of the principles and prac­ tices of plant breeding. Lectures, supplemented by periods in the greenhouse and experimental fields. A one-day field trip is taken. STATISTICS AND BIOMETRY 210. S T A T I S T I C A L M E T H O D S I. Fall term. Credit three hours. Prerequisite, graduate standing or permission of instructor. Lectures, T Th S 10. Warren 245. One hour laboratory, to be arranged. Associate Professor S t e e l . A simple formalization of everyday notions of odds and probability leads to a dis­ cussion of the distributions commonly encountered in the statistics applied to biology and related fields. The results, together with principles of scientific experimentation and statistical method, are applied to the conducting of experiments and the inter­ pretation of results. The nature and validity of experimental error are thoroughly treated. Topics include analysis of variance for n-way classifications, tests of hypoth­ eses, linear regression, correlation, treatment of discrete data, and sample surveys. 211. S T A T I S T I C A L M E T H O D S II. Spring term. Credit three hours. Prerequi­ site, course 210 or equivalent. Lectures, T Th S 10. Warren 245. One hour laboratory, to be arranged. Associate Professor S t e e l . The work of course 210 is continued. Further application of the material includes randomized block and Latin square designs, analysis of covariance, analysis of vari­ ance of 2-way classifications with disproportionate numbers, factorial experiments, individual degrees of freedom, multiple and curvilinear regression, curve fitting, and new developments in statistics. 212. E X P E R I M E N T A L M E T H O D S . Spring term. Credit two hours. Prerequi­ site, course 211 or the equivalent. F 2-4. Plant Science 141. Professor A t w o o d . The use of statistical methods and experimental design in problems of plot tech­ nique and related agricultural research. 213. D E S I G N O F E X P E R I M E N T S . Fall term. Credit three hours. Prerequisite, course 211 or equivalent. M W F 8. Plant Science 141. Laboratory to be arranged. Professor F e d e r e r . Plot and pen techniques, extensions and variations of the completely randomized complete block, and Latin square designs, the factorial experiment and confounding, lattice designs, crossover designs, covariance analyses, tests for ranked means, and variance component analyses. 214. A D V A N C E D S T A T I S T I C S . Spring term. Credit three hours. Prerequisite, course 213 or equivalent. M W F 8. Warren 31. Laboratory, to be arranged. Pro­ fessor Federer. Selected topics, depending upon the need and background of the student, from the following: long-term experiments, combination of results from several experi­ ments, sequential experimentation, variance component analyses, estimation pro­ cedures, linear hypotheses, heritability studies, and related topics. DEPARTMENTAL SEMINAR AND RESEARCH 150. U N D E R G R A D U A T E R E S E A R C H I N P L A N T B R E E D I N G A N D G E ­ N E T I C S . Fall, spring, or summer. Credit one or more hours by arrangement with instructor. Open to properly qualified seniors. Prerequisites, course 101 or 102 and permission to register. Members of the departmental staff. 222. S E M I N A R . Fall and spring terms. Without credit. Required of graduate students taking either a major or a minor in this Department. Open to qualified seniors. F 4:30. Plant Science. Seminar Room. Members of the departmental staff. PLANT PATHOLOGY 1. E L E M E N T A R Y P L A N T P A T H O L O G Y . Fall or spring term. Credit three hours. Prerequisite, Botany 1 or the equivalent. For graduates and undergraduates. •Lecture, Th 11. Plant Science 141. Practice and conferences, T Th, T F, W Th, or W F 2 - 4 :3 0 . Plant Science 3 4 1 , 3 4 3 , and 3 6 2 . Assistant Professors B o o t h r o y d and R o b e r t s . An introductory course dealing with the nature, cause, and control of disease in plants. Some of the more common diseases of cultivated crops are studied in the lab­ oratory. 2. P R I N C I P L E S O F P L A N T - D I S E A S E C O N T R O L . Fall or spring term. Pref­ erence to undergraduate students in fall and to graduate students in spring. Credit three hours. Prerequisite, course 200 or 1, or the equivalent. Lecture, time to be arranged. Plant Science 336. Practice, T Th 2-4:30. Plant Science 342. Professor L. J. Tyler and assistant. A consideration of the principles and methods of controlling plant diseases. This includes studies on exclusion by laws, regulations, quarantine, inspection, and dis­ infection; eradication by pruning, seed selection, rotation, disinfection, and other means; protection by spraying, dustring, wound dressing, and the like; immuniza­ tion by selection, breeding, and feeding. Number taking the course limited to twenty-four. 111. D I S E A S E S O F T R E E S A N D S H R U B S . Fall term. Credit three hours. Pre­ requisite, course 1 or 200. Lecture, W 10. Plant Science 336. Laboratory, F 2-4:30, and one period to be arranged. Plant Science 362. Professor Welch. A course dealing with the diseases peculiar to woody plants, their recognition and treatment. 2 0 0 . G E N E R A L P L A N T P A T H O L O G Y . Fall term. Credit four hours. For graduate students with their majors or minors in plant pathology. Open also to qualified graduate students in other fields. Prerequisite, permission to register. Lec­ ture, T i l . Plant Science 336. Practice, three periods weekly, two on T W Th or F 2 -4 and one at the students’ convenience. Assistant Professors B o o t h r o y d and R o b erts. This course is designed to give the entering graduate student an introduction to the basic features and techniques of the science of phytopathology and to provide an adequate foundation for successful prosecution of research in this field. .201. A D V A N C E D P L A N T P A T H O L O G Y Fall and spring terms. Credit three hours. Designed for students specializing in plant pathology. Prerequisite, courses 2, 200, 121, or 221, and permission to register. Lecture, T 9. Plant Science 336. Practice, T Th 10-12:30. Plant Science 304. Professor Ross and assistant. A presentation and analysis of the experimental and empirical knowledge of plant diseases. The phenomena of inoculation, infection, susceptibility, and suscept reac­ tions are critically considered. Major attention is given to the virus diseases and the nature of viruses. 121. C O M P A R A T I V E M O R P H O L O G Y O F F U N G I . Fall term. Credit four hours. Given in alternate years. Prerequisite, Botany 1 or its equivalent, and per­ mission to register. Lectures, M W 11. Plant Science 336. Practice, M W 2-4:30. Plant Science 329. Assistant Professor K o r f . An introductory course in mycology. Emphasis is placed on morphology rather than on taxonomy. [221. M Y C O L O G Y . Fall and spring terms. Credit five hours. Given in alternate years. Prerequisite, Botany 1 or its equivalent and permission to register.] Not given in 1953-54. A more intensive course than the preceding, designed especially for students specializing in mycology or plant pathology. Emphasis is placed on morphology and taxonomy, but other aspects of mycology are embraced. Practice in identification of specimens is afforded in various groups, and field work in fall and spring is en­ couraged. 222. A D V A N C E D M Y C O L O G Y . Fall or spring term, providing laboratory space is available. Credit from three to five hours. Prerequisite, course 121 or 221, and permission to register. Weekly conferences, laboratory periods, and occasional lec­ tures, to be arranged. Plant Science 329. Assistant Professor K o r f . A special-problems course designed for students majoring or minoring in mycology or in mycological phases of plant pathology. The type of problem selected varies to suit the student’s needs and inclinations. He is expected to gain an insight into re­ search methods and the literature. The course offers an opportunity for intensive work on a restricted phase of the subject, such as physiology, morphology, or tax­ onomy. 244. M Y C O L O G Y C O N F E R E N C E S . Fall and spring terms. Credit one hour. Required of all majors and Ph.D. minors in mycology, but open to others by permis­ sion. Time to be arranged. Plant Science 3 3 6 . Assistant Professor K o r f . A weekly discussion period designed to supplement the formal mycology courses by giving additional emphasis to problems in morphology, taxonomy, nomenclature, genetics, cytology, and physiology. [231. H I S T O R Y O F P L A N T P A T H O L O G Y . Fall and spring terms. Credit one hour. Prerequisite, course 1 and a reading knowledge of French and German.] Not given in 1953-54. 241. U N D E R G R A D U A T E R E S E A R C H . Fall or spring term, or both. Credit three hours or more. Registration by permission. Not less than three laboratory periods of three clock hours each week. Professors, Associate Professors, and Assist­ ant Professors of the departmental staff. This course is designed to afford opportunity for selected undergraduates to test their inclination and ability to do research work. The student is expected to pros­ ecute with interest and enthusiasm, under informal direction of the professor, some problem or problems mutually agreed upon. 242. S E M I N A R . Fall and spring terms. Required of graduate students taking work in the Department. T 4:30-6. Plant Science Seminar Room. 243. L I T E R A T U R E R E V I E W . Fall and spring terms. Members of the staff and graduate students. Optional. Biweekly. Time to be arranged. POMOLOGY Students desiring to do their major work in pomology may obtain a suggested sequence of courses for the four-year period by consulting the Department. 1. G E N E R A L P O M O L O G Y . Fall or spring term. Credit three hours. Should be preceded or accompanied by elementary courses in botany and chemistry. Lectures, T Th 8. Plant Science 233. Laboratory: fall term, T or W 2-4:30; spring term, M T W or Th 2-4:30. Plant Science 107. Spring term: Professor Smock; fall term: Associate Professor Edgerton. A study of the general principles and practices in pomology and their relation to the underlying sciences; propagation and care of orchard trees and small fruits; harvesting, storing, and marketing fruit; practical work in budding, grafting, prun­ ing, and planting; study of varieties, growth, and fruiting habits. 102. F R U I T V A R I E T I E S . Fall term. Credit three hours. Prerequisite, course 1. Lecture, T Th 12. Laboratory, S 8-10:30. Plant Science 114. Professor Boynton, Associate Professor Slate, and Assistant Professor Lamb. A systematic study of the most important varieties of apples, pears, peaches, plums, grapes, and small fruits from the standpoint of their identification, growth characters, and special cultural requirements. The development of new varieties by breeding and methods of testing and evaluating them are discussed. At least one field trip is given. 111. H A N D L I N G , S T O R A G E , A N D U T I L I Z A T I O N O F F R U I T . Fall term. Credit three hours. Prerequisite, course 1. Lectures, T Th 8. Plant Science 143. Laboratory, Th or F 2-4:30. Plant Science 107. Professor Smock and M r.---------. Emphasis is placed on the practices and problems of handling apples, but the work covers also such fruits as peaches, pears, and grapes, insofar as these are avail­ able. The important factors in handling fruit that affect quality and marketability, including the chemistry and physiology of fruits before and after harvest, are studied. The effect of grades and packages on distribution and marketing is fully discussed, with some attention to the problems of market inspection. Consideration is given to the principles and practices of common, cold, and controlled atmospheric storage, and to the utilization of fruits in the dried, canned, frozen, or juice forms. One Saturday and one afternoon field trip are required. 112. A D V A N C E D L A B O R A T O R Y C O U R S E . Spring term. Credit two hours. S 8-1. Plant Science 107. Intended for students doing their major work in pomology. Professors Hoffman and Boynton and Associate Professor Edgerton. This course is designed to give more extended practice in the various orchard operations than can be given in course 1. Special attention is given to problems of pruning, grafting, orchard-soil selection and management, pollination, and spray practice. Several field trips extending into the afternoon are made. 1 2 1 . E C O N O M I C F R U I T S O F T H E W O R L D . Fall term. Credit three hours. Prerequisite, course 1. Given in alternate years. Lectures, M W F 9. Plant Science 11 4 . Professor B o y n t o n . A study of all species of fruit-bearing plants of economic importance, such as the date, the banana, the citrus fruits, the nut-bearing trees, and the newly introduced fruits, with special reference to their cultural requirements in the United States and its insular possessions. All fruits not considered in other courses are considered here. The course is designed to give a broad view of world pomology and its relationship with the fruit industry of New York State. [131. A D V A N C E D P O M O L O G Y . Fall term. Credit three hours. Prerequisite, courses 1 and 102 and Botany 31. Professor H o f f m a n or B o y n t o n .] Given in alter­ nate years. Not given in 1953-54. A comprehensive study of the sources of knowledge and opinions as to practices in pomology. The results of experiences and research pertaining to pomology are discussed, with special reference to their application in the solution of problems in commercial fruit growing. 231. S P E C I A L T O P I C S I N E X P E R I M E N T A L P O M O L O G Y . Spring term. Credit three hours. Open to qualified seniors and to graduate students. Given in alternate years. Hours to be arranged. Professors H o f f m a n , B o y n t o n , and S m o c k and Associate Professor E d g e r t o n . In this course the student is expected to review critically and evaluate the more important original papers relating to various phases of pomological research. Re­ cent experimental methods applicable to the topic are fully considered. 200. S E M I N A R . Fall and spring terms. Without credit. Required of students taking course 201 and graduate students in pomology, T i l . Plant Science Seminar Room. Members of the departmental staff. 201. R E S E A R C H . Fall, spring, or both terms. Credit two or more hours a term. Prerequisite, course 131. Professors H e i n i c k e , H o f f m a n , S m o g k , and B o y n t o n and Associate Professors E d g e r t o n and F i s h e r . POULTRY HUSBANDRY Four-year students interested in specializing in poultry husbandry may obtain two suggested sequences of courses by consculting the student advisers in the de­ partment. One is designed for students who intend to engage in some phase of poultry production or in a business allied with it, while the second is planned for students who are interested in preparing for a career in research or teaching in such specialized fields as poultry genetics, nutrition, or physiology. Course 1 is a prerequisite for all other courses. Specially qualified students may have this prerequisite waived for some courses by permission of the instructors con­ cerned. 1. F A R M P O U L T R Y . Fall term. Credit three hours. Lectures, M W F 10. One recitation period, to be arranged. Rice 3 0 0 . Professor H a l l , assisted by other mem­ bers of the staff. A general course dealing with the practical application of the principles of poultry husbandry to general farm conditions. 50. M A R K E T E G G S A N D P O U L T R Y . Spring term. Credit two hours Prereq­ uisite, course 1. Lecture, T i l . Laboratory, T W or Th 2-4. Rice 101. Professor H a ll. A detailed study of the interior and exterior qualities of eggs, abnormalities, egg grades, and standards; practice in candling, grading, and packing. Grades and standards of market poultry; killing, dressing, and packing. General market infor­ mation. 170. P O U L T R Y H Y G I E N E A N D D I S E A S E . Fall term. Credit two hours Pre­ requisite, courses 30 and 110, Bacteriology 1 or 3, and Animal Physiology 10 or Human Physiology 303. Lecture and laboratory, Th 2-4:30. Moore Hall. Assistant Professor P e c k h a m . 1he course deals with the nature of the infectious and parasitic diseases of poultry and with the principles of hygiene applicable to poultry farming for the prevention and control of diseases. 190. P O U L T R Y P R O B L E M S . Fall or spring term. Credit, one, two, or three hours. Open to juniors or seniors. Prerequisite, written permission of staff member concerned. Investigation of some problem in the field oil poultry husbandry by the student under the direction of a member of the staff. Professor Bruckner. 209. S E M I N A R I N P O U L T R Y B I O L O G Y . Fall and spring terms. For graduate students. F 4:15. Rice 201. Members of the departmental staff. A survey of recent literature and research in poultry biology. GENETICS AND ANATOMY 20. P O U L T R Y B R E E D S , B R E E D I N G , A N D J U D G I N G . Fall term. Credit three hours. Prerequisite, course 1. Lecture or recitation, T Th 10. Rice 101. Lab­ oratory, T or W 2-4. Judging Laboratory. Professor Hall. Selecting and judging birds for production and breed characters; origin, history, and classification of breeds; introduction to breeding. 120. P O U L T R Y G E N E T I C S . Spring term. Credit three hours. Open to gradu­ ate students, seniors, and juniors. Prerequisite, Zoology 104, Plant Breeding 101, or their equivalents and permission of the instructor. Given in alternate years. Lectures, M W F 9. Rice 201. Professor Hutt. A survey of inherited characters in domestic birds, cytology, linkage, inbreeding, hybrid vigor, resistance to disease, genetic principles in poultry breeding, physiology of avian reproduction, infertility, embryonic mortality, and avian endocrinology. 124. A N I M A L G E N E T I C S . Spring term. Credit three hours. For Veterinary stu­ dents. Lectures, T Th 9. Moore Hall. Laboratory and discussion, W 2. Rice 201 and 305. Professor Hutt. Principles of genetics; sex determination and sex linkage; inherited characters in domestic animals, with special reference to lethal genes and genetic resistance to disease; progeny-testing; inbreeding and cross-breeding. 140. A N A T O M Y O F T H E F O W L . Fall term. Credit three hours. Open to jun­ iors, seniors, and graduate students. Prerequisite, course 1 and permission of the instructor. Given in alternate years. Lectures, T Th 8. Rice 201. Laboratory, F 2-4. Rice 201. Professor Cole. The lectures, supplemented by laboratory periods for study and dissection, are designed ot asquaint the student with the anatomy of the fowl. NUTRITION .110. P O U L T R Y N U T R I T I O N Spring term. Credit three hours. Prerequisite, course 1. Not open to freshmen. Lectures, T Th 9. Rice 101. Laboratory, Th or F 2-4. Rice 305. Professor Heuser. The principles of poultry nutrition and their application to poultry feeding management. 210. A D V A N C E D P O U L T R Y N U T R I T I O N . Spring term. Credit two hours. For graduate students. Not given every year and not unless ten or more students apply for the course. Registration by appointment. Discussion and laboratory period, Th 2-4. Rice 201. Professor Norris and Associate Professor Scott. A presentation of one or more important fields of research in poultry nutrition, a critical consideration of the experimental methods used in conducting the investi­ gations, and a discussion of further studies needed, including the planning of the experiments. .219. S E M I N A R I N A N I M A L N U T R I T I O N Fall term. Credit one hour. Open to graduate students with major field of study in animal nutrition. Prerequisite, Animal Husbandry 110 or the equivalent. Registration by permission. T 4:30. Rice 201. Animal Nutrition staff. A critical review of the literature and other topics of special interest to graduate students in animal nutrition. INCUBATION AND EMBRYOLOGY 30. I N C U B A T I O N A N D B R O O D I N G . Spring term. Credit three hours. Pre­ requisite, course 1. Not open to freshmen. Lectures, T Th 10. Laboratory, M or T 2-4. Rice 201. Assistant Professor King. Principles of incubation and brooding of domestic and game birds; problems of hatchery management. [230. A V I A N E M B R Y O L O G Y . Spring term. Credit two hours. For graduate students. Undergraduate students by special permission. Prerequisite, Biology 1 or Zoology 104, or the equivalent. Given in alternate years with course 235. Professor Romanoff.] Not given in 1953-54. The principles of embryonic growth and development, with specific emphasis on various manifestations of biochemical phenomena. The study in general, is designed to provide basic facts for natural and artificial propagation of birds. 235. T H E A V I A N E G G . Spring term. Credit two hours. Given in alternate years with course 230. For graduate students and qualified juniors and seniors. Prerequi­ site, Biology 1 or Zoology 104, or the equivalent, and permission of the instructor. Hours to be arranged. Professor Romanoff. Biological constitution and physiochemical properties of the egg as a reproductive cell, and as an article of food. 239. S P E C I A L T O P I C S I N C H E M I C A L E M B R Y O L O G Y . Fall term. Credit one hour. Registration by permission. Rice Hall. Professor Romanoff. A critical review of current literature. RURAL EDUCATION PROGRAM FOR THE PREPARATION OF SECONDARY-SCHOOL TEACHERS* With careful planning it is possible to meet the requirements for a Bachelor of Science degree in Agriculture and, at the same time, the certification requirements for teaching. Therefore, students who desire to prepare for teaching science or vo­ cational agriculture should plan their freshman and sophomore programs, with the appropriate adviser, in nature study and science teaching or vocational agriculture. Those planning to teach science begin their professional studies in the junior year by taking courses in Educational Psychology (Rural Education 111), Human Development 201 and 202, and Social Foundations (Rural Education 190) and complete the required courses in methods and practice teaching by registering for Education 130 and Rural Education 128 and 129 in their senior year. Students planning to teach vocational agriculture should register for Human De­ velopment 201 and 202 and Rural Education 131 in their junior year, and for Rural Education 111, 132, and 134 in their senior years. These courses are given by mem­ bers of the staff at off-campus training centers while the students are doing practice teaching in rural high schools. Certification may then be completed by registering for Rural Education 190 during the other semester of the senior year. *For other courses in education, consult the Announcements of th e Schools of E ducation and of In­ dustrial and Labor Relations, of the Colleges of Home Economics and A rts and Sciences. [106. O U T D O O R L I V I N G A N D C A M P A D M I N I S T R A T I O N . Fall term. Credit three hours. Registration by permission of instructors only. Assistant Professor Eckert and Doctor Noakes.] Not given in 1953-54. 107. T H E T E A C H I N G O F N A T U R E S T U D Y A N D E L E M E N T A R Y S C H O O L S C I E N C E . Spring term. Credit two hours. Open to juniors, seniors, and graduate students, particularly those who are preparing to teach or supervise nature study or science. Lecture, S 8. Practical exercises, S 9-11:30. Fernow 8. Associate Professor Gordon. The content and methods of nature study and of elementary-school science, with field work and laboratory experience useful in classroom and camp. 108. F I E L D N A T U R A L H I S T O R Y . Fall or spring term. Credit two hours a term. Open to juniors, seniors, and graduate students, and to sophomores with per­ mission of instructors. Lecture, T 4:30. Fernow 8. Field work, T 2-4:30. Fall term, Assistant Professor Eckert and Professor---------. Spring term, Associate Professor Gordon and Professor---------. Field trips and lectures devoted to a study of the natural history of several ecolog­ ical units under different seasonal conditions, with special emphasis on the teaching of science and conservation. May be taken one or both terms. 128. M E T H O D S O F T E A C H I N G S C I E N C E I N S E C O N D A R Y S C H O O L S . Fall term. Credit three hours. Prerequisite or parallel, Education 130 and permission of the instructor. For seniors and graduate students. Th 2-5:30 and additional hours to be arranged. Assistant Professor Eckert. A consideration of methods and materials useful in teaching science in secondary schools. Observation of the work of experienced teachers constitutes an important part of the course. 129. P R A C T I C E I N T E A C H I N G S C I E N C E I N S E C O N D A R Y S C H O O L S . Fall or spring term. Credit four hours. Prerequisite, course 128 and permission of the instructor. For seniors and graduate students. Hours to be arranged. Assistant Professor Eckert. Supervised practice in teaching science in secondary schools, with frequent con­ ferences on teaching plans and problems. [202. N A T U R E L I T E R A T U R E . Fall term. Credit two hours. Given in alternate years. Open to seniors and graduate students interested in science and science teaching. Associate Professor Gordon.] Not given in 1953-54. [203. R E S E A R C H A N D W R I T I N G I N N A T U R E A N D C O N S E R V A T I O N E D U C A T I O N . Spring term. Credit two hours. Given in alternate years. Professor ---------.] Not given in 1953-54. 205. T H E T E A C H I N G O F C O N S E R V A T I O N . Spring term. Credit two hours. T Th 10. Fernow 8. Assistant Professor Eckert. Consideration of the principles, materials, and methods of conservation educa­ tion useful to teachers and others engaged in teaching wise use of the resources of the nation. 207. M E T H O D S A N D M A T E R I A L S F O R T H E T E A C H I N G O F S C I E N C E I N S E C O N D A R Y S C H O O L S . Spring term. Credit two hours. Registration by per­ mission only. Hours to be arranged. Fernow 8. Assistant Professor Eckert. A consideration of problems of selection and organization of subject matter, of choice and use of materials, and of methods of teaching earth science at the sec- ondary-school level. 209. T H E D E V E L O P M E N T O F N A T U R E A N D S C I E N C E E D U C A T I O N I N T H E U N I T E D S T A T E S . Fall term. Credit two hours. Given in alternate years. Lectures, M W 10. Fenrow 8. Associate Professor Gordon. A survey of origins and developments in nature and science education, both in and out of schools, with emphasis on leaders and their philosophies. 226 R E S E A R C H I N N A T U R E S T U D Y , S C I E N C E , A N D C O N S E R V A T I O N E D U C A T I O N . Fall or spring term. Credit one hour a term. W 12. Fernow 8. Associ­ ate Professor G o r d o n , Assistant Professor E c k e r t , and Professor---------. A seminar dealing with special problems. EDUCATIONAL PSYCHOLOGY 10. P S Y C H O L O G Y . Fall or spring term. Credit three hours. May not be taken for credit by students who have had Psychology 101 or the equivalent. M W 10 and one hour to be arranged. Plant Science 233. Assistant Professor A h m a n n . Designed for students who are not preparing to teach. Should not be taken by students planning to take course 111. Consideration of the outstanding psychological concepts that bear upon personal problems and upon business and social relation­ ships. .111. E D U C A T I O N A L P S Y C H O L O G Y Fall or spring term. Credit three hours. Prerequisite, Human Development. Not open to freshmen. Lectures, M W F 9. Warren 3 4 5 . Professor G l o c k . Consideration of the outsanding facts and principles of psychology bearing upon the problems of education. 117. P S Y C H O L O G Y O F A D O L E S C E N C E . Spring term. Credit three hours. Prerequisite, a course in elementary or educational psychology. M W F 11. Caldwell 100. Associate Professor E l l i o t t . A study of behavior during adolescence, of tasks involved in developing maturity and of the effects on development of some social conditions. .211. E D U C A T I O N A L P S Y C H O L O G Y Fall term. Credit three hours. For ma­ ture students with teaching experience. M F 11-12:30. Stone. Professor G l o c k . Special emphasis is given to the topics of learning, adjustment, and evaluation, and their relationship to the teacher’s problems. [213. S E M I N A R I N E D U C A T I O N A L P S Y C H O L O G Y . Fall term. Credit two hours. Alternates with course 299. Assistant Professor A h m a n n .] Not given in 1953-54. [218. S E M I N A R I N E D U C A T I O N A L P S Y C H O L O G Y . Spring term. Credit tw o hours. Prerequisite, permission of the instructor. Professor G l o c k . ] Not given in 1953-54. 219. S E M I N A R IN P E R S O N N E L A D M I N I S T R A T I O N IN E D U C A T I O N A L I N S T I T U T I O N S . Spring term. Credit two hours. For graduate students in educa­ tion. Th 4-6. Warren 201. Professor W i n s o r . Personnel management in relation to school administration. [251. E D U C A T I O N A L M E A S U R E M E N T . Spring term. Credit three hours. Candidates with course for a 256. Aprssinisctiapnatl’Ps rcoefretsisfoicraAtehmmaaynrne.g] isNteort for two hours’ credit. given in 1953-54. Alternates 2 5 3 . I N T R O D U C T I O N T O E D U C A T I O N A L S T A T I S T I C S . Fall term. Credit three hours. T Th 9 - 1 0 :3 0 . Warren 3 4 5 . Assistant Professor A h m a n n . A study of common statistical procedures encountered in educational literature and research. The course includes the computation and interpretation of descriptive measures and tests of significance. 254. S T A T I S T I C A L I N S T R U M E N T S I N E D U C A T I O N . Spring term. Credit two hours. Prerequisite, course 253 or permission of the instructor. T Th 9. Warren 345. Assistant Professor Ahmann. A study of the analysis of variance, the analysis of covariance, the discriminant function, test item analysis, and supporting topics. 255. U S E A N D I N T E R P R E T A T I O N O F T E S T S I N G U I D A N C E A N D P E R ­ S O N N E L A D M I N I S T R A T I O N . Fall term. Credit two hours. Open to students in guidance or personnel administration. T h 4 -6 . Stone. Assistant Professor A n d r u s . This course deals with the development, use, and interpretation of aptitude tests as a basis for guidance and selection. 256. A C H I E V E M E N T T E S T C O N S T R U C T I O N A N D A N A L Y S I S . Spring term. Credit two hours. Prerequisite, course 253 and a course in educational meas­ urement, or permission of instructor. Alternates with course 251. T Th 10. Warren 345. Assistant Professor A h m a n n . A study of the theory and construction of achievement tests. Item analysis is also stressed. 315. R E A D I N G I N T H E S E C O N D A R Y S C H O O L . Spring term. Credit two hours. M 4-5:30. Warren 31. Professor G l o c k . A course which purposes to aid those interested in secondary education in the lo­ cation of reading problems, in the determination of causes of reading difficulty, and in the organization of developmental and remedial programs. [316. R E A D I N G C L I N I C . Prerequisite, course 315. Professor G l o c k . ] Not given in 1953-54. EXTENSION EDUCATION 2 2 3 . S E M I N A R I N E X T E N S I O N E D U C A T I O N . Throughout the year. Credit two hours each term. Open to graduate students in Extension Education and others interested in extension education. W 2 - 3 :3 0 . Warren 2 6 0 . Professor L e a g a n s . Provides opportunity for special study of individual problems, for group study of common problems and for exchange of experiences among workers from various states and countries. 224. P R O G R A M B U I L D I N G I N E X T E N S I O N E D U C A T I O N . Fall term. Credit two hours. For graduate students in Extension Education and others interested in adult education. T 2-3:30. Warren 160. Professor L e a g a n s . A study of the basic problems, principles, and procedures in the process of ex­ tension program building in both agriculture and homemaking. 225. T E A C H I N G I N E X T E N S I O N E D U C A T I O N . Spring term. Credit two hours. For graduate students in Extension Education and others concerned with teaching adults. T 2-3:30. Warren 260. Professor L e a g a n s . The course deals with the principles of teaching and learning and their applica­ tion in extension teaching. Major problems, including the formulation of learning situations, selection, and organization of learning experiences, selection and use of extension methods and evaluation of teaching, are considered. 291. SEMINAR IN T H E D E V E L O P M E N T A N D E X E C U T I O N OF E D U C A ­ TIONAL P R O G R A M S IN U N D E R D E V E L O P E D AREAS O R COMMUNITIES. Fall term. Credit two hours. Th 2-3:30. Stone. Professor L e a g a n s . Designed for teachers, extension workers, missionaries, government workers, and others who expect to do educational work in underdeveloped areas of the free world. Analysis is made of the cultural, social, educational, and economic factors in selected areas as background for forming program development and teaching pro­ cedures. [298. R U R A L E D U C A T I O N A L L E A D E R S H I P . Spring term. Credit two hours. For graduate students and advanced undergraduate students. Especially appropriate for public school teachers, school principals, social workers, agriculture and home economics workers, and directors of adult education. Professor Leagans.] Not given in 1953-54. Courses that offer additional basic w o r k in this field are: Rural Education 211, 219, 243, 244, 296, 299. Home Economics 348, 361, 415, 430, 437, 440, 459. Rural Sociology 105, 132, 212, 218. Agricultural Economics 102, 140, 181, 236, 251. Extensive flexibility is permitted students in the selection of a course program to meet his special interests and professional needs. AGRICULTURAL EDUCATION 131. I N T R O D U C T I O N T O T E A C H I N G V O C A T I O N A L A G R I C U L T U R E . Spring term. Credit one hour (part of the ten-hour unit). Required of juniors and others entering the directed teaching program in the senior or following year. M 2-4:30. Warren 160. Staff in Agricultural Education. A seminar type of course, with observations in near-by departments of agriculture, in orientation, preparation and selection of the trainee for directed teaching in offcampus cooperating school centers. 132. M E T H O D S , M A T E R I A L S , A N D D I R E C T E D P R A C T I C E I N V O C A ­ T I O N A L A G R I C U L T U R E I N T H E S E C O N D A R Y S C H O O L . Fall term. Credit nine hours. Staff in Agricultural Education. Directed participation in off-campus centers in the specific and related problems of teaching prevocational and vocational agriculture on the junior and senior high school levels, to include adjustment in the school and community; evaluation of area resources, materials of instruction and school facilities; organization and de­ velopment of local courses of study; launching and directing supervised farming programs; planning for and teaching all-day classes; advising Future Farmer chap­ ters; and other problems relating to development of a balanced program for Voca­ tional Education in Agriculture in a local area. 133. S P E C I A L P R O B L E M S I N V O C A T I O N A L A G R I C U L T U R E . Spring term. Credit as arranged. Staff in Agricultural Education. Selected problems in Vocational Agriculture to meet particular needs of prospec­ tive teachers. 134. T H E O R G A N I Z A T I O N A N D D I R E C T I O N O F Y O U N G F A R M E R G R O U P S . Fall term. Credit three hours. Professor Hoskins and staff in Agricul­ tural Education. Directed participation in off-campus centers in problems of serving the needs of young men on farms to include their location and organization in local areas; the planning of local programs; the evaluation of their qualifications and opportunities for placement and progressive establishment in farming or in the related-farm occupations; and their cooperative relationships with, and the training for leader­ ship in, other youth and adult organizations. 230. S E M I N A R I N A G R I C U L T U R A L E D U C A T I O N . Spring term. Credit two hours. For students whose progress in graduate study is satisfactory. T 7-9 p.m. Stone. Staff in Agricultural Education. 231. S U P E R V I S I O N I N V O C A T I O N A L A G R I C U L T U R E . Fall term. Credit two hours. Open to students with experience in teaching vocational agriculture, or by permission. M 4:15-6. Stone. Associate Professor W. A. Smith. 232. M E T H O D S O F I N S T R U C T I O N I N V O C A T I O N A L A G R I C U L T U R E . Spring term. Credit two hours. Open to students with experience in teaching voca­ tional agriculture. M 7-9 p.m. Stone. Assistant Professor Kunsela. Consideration is given to the selection of units of instruction, developing specific teaching objectives, analysis of farming problems, selection of teacher-pupil activi­ ties, and the evaluation of learning experiences as applied to individual and group instruction. 233. S U P E R V I S E D F A R M I N G P R O G R A M S I N V O C A T I O N A L A G R I C U L ­ T U R E . Fall term. Credit two hours. M 7-9 p.m. Stone. Doctor Noakes. The basic concepts in planning and using supervised farming programs. Field studies of programs in near-by schools. 234. E D U C A T I O N F O R L E A D E R S H I P O F F A R M Y O U T H A N D A D U L T G R O U P S . Fall term. Credit two or three hours. F 4 : 1 5 - 6 . Stone. Professor H o s k i n s . Designed for leaders in the fields of agricultural education who are responsible for organizing programs. A consideration of the objectives and trends in part-time education and in social-economic problems in rural areas. [235. T H E P R E P A R A T I O N O F T E A C H E R S I N V O C A T I O N A L A G R I C U L ­ T U R E . Fall term. Credit two or three hours. Associate Professor W. A. Smith.] Not given in 1953-54. [236 T H E O R G A N I Z A T I O N A N D A D M I N I S T R A T I O N O F V O C A T I O N A L A G R I C U L T U R E I N T H E S E C O N D A R Y S C H O O L . Spring term. Credit two or three hours. Professor Hoskins.] Not given in 1953-54. 237. P L A N N I N G C O U R S E S O F S T U D Y A N D P R O G R A M S O F W O R K F O R V O C A T I O N A L E D U C A T I O N I N A G R I C U L T U R E . Spring term. Credit three hours. Registration by permission. Th 4:15-6 and one hour by appointment. Special trips to be arranged. Warren 160. Doctor Noakes. The development of basic and individualized courses of study and comprehensive programs of work. An evaluation of the effectiveness of vocational education in agriculture in selected high-school departments to determine patterns for course building and program planning. [238. M A T E R I A L S O F I N S T R U C T I O N I N V O C A T I O N A L A G R I C U L ­ T U R E . Fall term. Credit two hours. Open to students with experience in teaching vocational agriculture. Assistant Professor Kunsela.] Not given in 1953-54. [239. P R E V O C A T I O N A L A G R I C U L T U R E I N T H E S E C O N D A R Y S C H O O L . Spring term. Credit two hours. Associate Professor W. A. Smith.] Not given in 1953-54. SUPERVISION [241. T H E P R E P A R A T I O N O F T E A C H E R S F O R N O R M A L S C H O O L S A N D C O L L E G E S . Spring term. Credit two hours. Professor C. B. Moore.] Not given in 1953-54. 243. P R O C E D U R E A N D T E C H N I Q U E S I N S U P E R V I S I O N . Fall term. Credit three hours. Candidates for a principal’s certificate may register for two hours’ credit. M W F 10. Stone. Professor C. B. Moore. Designed for superintendents, supervisors, and principals. Students taking^ this course must be prepared to spend four full days or more in observing supervisory procedures in various school systems. 245. S E M I N A R F O R P R I N C I P A L S . Fall term. Credit two hours. Required of all graduate students who are candidates for a principal’s certificate. S 9-11. Stone. Professor C. B. Moore. [246. T H E S U P E R V I S I O N O F T H E E L E M E N T A R Y S C H O O L . Spring term. Credit three hours. Candidates for a principal’s certificate may register for two hours’ credit. Professor C. B. Moore.] Not given in 1953-54. 247. SEMINAR IN ELEMENTARY EDUCATION. Spring term. Credit two hours. S 9-10:40. Stone. Professor C. B. Moore. ADMINISTRATION 261. FUNDAMENTALS OF EDUCATIONAL ADMINISTRATION. Fall term. Credit three hours. T Th 11-12:30. Stone. Associate Professor E l l i o t t . An introduction to the study of administration, with special application to the educational program. Both the science and the art of administration are examined. 262. T H E S E C O N D A R Y - S C H O O L P R I N C I P A L S H I P . Fall term. Credit two hours. S 10:40-12:15. Warren 201. Associate Professor E l l i o t t . A course in school administration dealing with the responsibilities of the secondary-school principal within the school building. Special attention is given to the problems of the small high school. [263. T H E P R I N C I P A L S H I P O F T H E E L E M E N T A R Y S C H O O L Credit two hours. Professor C. B. Moore.] Not given in 1953-54. 264. S C H O O L F I N A N C E . Fall term. Credit two hours. Prerequisite course 261 or the equivalent. Th 4:15-5:45. Warren 201. Associate Professor E l l i o t t . Typical problems: how local school funds are levied, collected, and disbursedbudget making; bonding; sources of state funds and their distribution. w * - ™ S C H O O L P L A N T . Spring term. Credit two hours. Prerequisite, course 261 or the equivalent. Professor---------.] Not given in 1953-54. [267. L E G A L P R O B L E M S O F T H E S C H O O L A D M I N I S T R A T O R Credit two hours. M r.---------.] Not given in 1953-54. 268. S E M I N A R I N E D U C A T I O N A L A D M I N I S T R A T I O N . Spring term. Credit two hours. M 4-5:30. Stone. Associate Professor E l l i o t t . CURRICULUM AND SECONDARY EDUCATION 216 PRINCIPLES OF CURRICULUM BUILDING. Fall term. Credit two or three hours. W 4-6 and one hour to be arranged for those enrolled for three hours’ credit. Warren 2 0 1 . Associate Professor S t u t z . A consideration of major problems, principles, and techniques in determining the school curriculum. Students who enroll for curriculum work in a special field may take this course for two hours. [277. S E M I N A R I N C U R R I C U L U M . Spring term. Credit two hours. Prerequi­ site, course 276 or the equivalent. F 2-3:30. East Roberts 223. Associate Professor S t u t z . ] Not given in 1953-54. [278. S E M I N A R I N S E C O N D A R Y E D U C A T I O N . Spring term. Credit two hours. Associate Professor S t u t z . ] Not given in 1 9 5 3 -5 4 . 290. S E C O N D A R Y E D U C A T I O N . Fall term. Credit three hours. T Th S 9. Stone. Associate Professor S t u t z . A study of the nature, function, organization, curriculum, and extension of secondary education in its adaptations to present-day needs and conditions. 292. S E M I N A R I N S O C I A L S T U D I E S E D U C A T I O N . Fall term. Credit as arranged. T 4 : 1 5 . Associate Professor S t u t z . A course designed for resident or extramural students who are working on special problems in social studies education. GUIDANCE AND PERSONNEL 282. E D U C A T I O N A L A N D V O C A T I O N A L G U I D A N C E . Fall term Credit t.W° h° U/ S- For graduatc students only. S 9-11. Warren 145. Associate Professor A. G. Nelson. Principles and practices of educational and vocational guidance. Historical and theoretical background of the guidance movement; educational, vocational, and community information needed; the study of the individual group; group methods; counseling; placement and follow-up; the organization, administration, and ap­ praisal of guidance programs. 283. C O U N S E L I N G M E T H O D S . Spring term. Credit two hours. For graduate students only. Prerequisite, course 255 and 282 or their equivalent. T 2-4. Warren 2 0 1 . Associate Professor A. G. N e l s o n . Techniques for counseling with individuals concerning various types of educa­ tional, social, and vocational adjustment problems. Case studies. 284. G R O U P T E C H N I Q U E S I N G U I D A N C E . Spring term. Credit two hours. S 9-11. Warren 260. Associate Professor A. G. N e l s o n . Methods and materials for presenting occupational and orientation information to students. Deals with classes in occupations, orientation groups, field trips, clubs, work-experience programs, and other group methods. 285. O C C U P A T I O N A L A N D E D U C A T I O N A L I N F O R M A T I O N . Fall term. Credit four hours. T Th 1. Field trips, M afternoon. Stone. Associate Professor A. G. N e l s o n . Survey and appraisal of occupations and training opportunities; study of sources of educational and vocational information; job analysis; vocational trends. Field trips to places of employment. 289. S U P E R V I S E D P R A C T I C E I N T E S T I N G A N D C O U N S E L I N G . Spring term. Credit to be arranged. For advanced students only. Prerequisites, courses 255, 282, and 283, or their equivalents, and permission of the instructor. Hours for observation and practice to be arranged. W 5. Associate Professor A. G. Nelson. Practice in the administration, scoring, and interpretation of psychological tests. Observation and supervised experience in counseling at the Cornell Guid­ ance Center. Case conferences and assigned readings. GENERAL EDUCATION 190. S O C I A L F O U N D A T I O N O F E D U C A T I O N . Fall or spring term. Credit three hours. Must be approved by the instructor in charge. Fall term: M W F 9; spring term: M W F 11. Warren 231. Professor C. B. M o o r e . Evaluation of the school as a social institution and emphasis upon the role the school must play in a democratic society. 194. P R I N C I P L E S O F V O C A T I O N A L E D U C A T I O N . Spring term. Credit two hours. Primarily for graduate students whose interests and current or antici­ pated educational activities are in or concerned with vocational education. T 4:15-6. Warren 160. Associate Professor W. A. Smith. 199. I N F O R M A L S T U D Y I N E D U C A T I O N . Maximum credit, threehours each term. Members of the staff. This privilege is granted to a qualified student of junior rank or above, when approved by his adviser from the Education staff who is personally responsible for the study. 214. C O L L E G E T E A C H I N G . Fall term. Credit two hours. M 7-9 p.m. Warren 145. Associate Professor Stutz and others. Designed for those who plan to teach in higher institutions. Methods ofteach­ ing, organization of subject matter, motivation, learning, testing, grading and similar problems are treated. 244. P H I L O S O P H Y O F E D U C A T I O N . Spring term. Credit two hours. For mature students, preferably with teaching experience. W 4. Stone. Professor C. B. Moore. [293. A D M I N I S T R A T I O N A N D S U P E R V I S I O N O F A D U L T E D U C A T I O N . Credit three hours. Professor Hoskins.] Not given in 1953-54. 299. E D U C A T I O N A L R E S E A R C H M E T H O D S . Fall term. Credit two hours. For graduate students preparing for or engaged in research in education Alter­ nates with course 213. M W 11. Warren 345. Assistant Professor Ahmann. Consideration of the basic research methods as applied to education and the principles of thesis writing. 300. S P E C I A L S T U D I E S . Credit as arranged. Members of the staff. Students working on thesis or other research projects may register for this course. The staff members concerned must be consulted before registration. 400. I N T E R N S H I P I N E D U C A T I O N . Fall and spring terms. Credit from two to six hours, as arranged. Members of the staff. Opportunity for apprentice or similar practical experience on the graduate level in administration, agricultural education, guidance, personnel administration, supervision, and other types of professional service in education. [401. P R O B L E M S I N H I G H E R E D U C A T I O N . Spring term. Professor Stutz 1 Not given in 1953-54. J RURAL SOCIOLOGY 1. G E N E R A L S O C I O L O G Y F O R S T U D E N T S O F R U R A L L I F E . Fall or spring term. Credit three hours. May not be taken by those who have credit for Sociology and Anthropology 101. Not open to freshmen except in second term upon approval of the instructor. Lectures and discussions, M W F 8. Warren 45. Professor Anderson. This is a general introductory sociology course designed especially for students in agriculture and home economics. Its object is to create an understanding of the group, the ecological, and the institutional organization of society and how they function. Illustrations are chiefly from rural society. The general social organization is described to show the interrelatedness of society. 12. E F F E C T I V E C O M M U N I T Y L I V I N G . Fall or spring term. Credit three hours. Open to sophomores, juniors, and seniors. M W F 11-12:20. Warren 131. Associate Professor Reeder. This course is primarily concerned with helping students to acquire the kinds of understanding, skills, and attitudes that are essential in functioning effectively as members of a rural community. Students practice organization skills in the solu­ tion of laboratory problems. Principles are emphasized in relation to their appli­ cation. 105. O R G A N I Z A T I O N M E T H O D S . Fall term. Credit three hours. Prerequi­ site, course 1 or 12 or permission of the instructor. T Th 11-12:50. Warren 31. Associate Professor Reeder. A study of the methods and techniques by which officers, group members, and administrators may increase the effectiveness of organizations. Primary emphasis is given to organizations and service agencies which are found in rural society such as farm bureau, home bureau, Grange, 4-H, churches, schools, fraternal organiza­ tions, and civic clubs. The course is designed to give students experience in using some of the basic organization methods. 111. R U R A L C O M M U N I T Y O R G A N I Z A T I O N . Spring term. Credit three hours. Prerequisite, course 1 or 12 or permission of the instructor. M W F 9. Warren 232. Associate Professor Reeder. A consideration of the problems involved in helping people and organizations in a community work together to meet their common needs. Problems which arise in helping schools, churches, farm organizations, and civic groups in integrating themselves into the life of the community is one part of this consideration. Students are given the opportunity to practice some organization techniques which have been found successful in community organization work. 123. P A R T I C I P A T I O N I N S O C I A L A G E N C I E S . Fall or spring term. Hours and credit to be arranged. Prerequisite, permission of the instructor. Associate Professor Taietz. This course is open to a limited number of mature students in the preprofes­ sional social-work curriculum who are planning to take a beginning job in social work after graduation. 124. T H E F I E L D O F S O C I A L W O R K . Fall term. Credit three hours. Not open to freshmen or sophomores. Prerequisite, one course in sociology and one course in psychology. Lectures and discussions, M W F 9. Warren 232. Associate Professor Taietz. This course considers the field of social work and its services designed to meet a wide range of human needs growing out of social, economic, and emotional mal­ adjustments. An understanding of social work is developed through a study of the processes of social case work, social group work, and community organization. Consideration is given to social work as a career, the professional knowledge and skill necessary for the practice of social work, and how these can be acquired through training. 126. S O C I A L S E R V I C E S T O I N D I V I D U A L S . Spring term. Credit three hours. Prerequisite, course 124 or permission of instructor. M W F 11. Warren 232. Associate Professor Taietz. An analytical study of attitudes and behavior commonly encountered in helping people who have personal and social problems. A survey of social case-work methods, with particular emphasis on the technique of interviewing. Discussion of case material provided by the instructor and from student’s own experience. [128. A N I N T R O D U C T I O N T O T H E P U B L I C S O C I A L S E R V I C E S . Fall term. Credit three hours. Prerequisite, course 124 or permission of instructor. Associate Professor Taietz.] Not given in 1953-54. The development of governmental responsibility for meeting economic need and social problems related thereto. An analysis of the basic concepts underlying the organization and administration of public social services. [1 2 9 . P U B L I C S O C I A L S E R V I C E S F O R C H I L D R E N . Spring term. Credit three hours. Associate Professor T a i e t z . ] Not given in 1 9 5 3 -5 4 . A study of the development of public responsibility for the care ofdependent, neglected, delinquent, and handicapped children. 131. F I E L D E X P E R I E N C E I N P U B L I C W E L F A R E . Fall or spring term. Credit three hours. Prerequisite, course 124 and permission of instructor. Ninety hours of practice work to be arranged. Associate Professor Taietz. This course is open to a limited number of mature students in the preprofessional social-work curriculum who are planning to take a beginning job in public welfare after graduation. Practice work and supervised research in a local public-welfare agency. 132. R U R A L L E A D E R S H I P . Spring term. Credit two hours. Prerequisite, per­ mission of the instructor. Th 2-4. Warren 31. Professor Larson. A study of the theories of leadership, a review of the significantresearch in the area of leadership, and a description and analysis of representative methods of recruiting and training lay leaders. Emphasis is on leadership in rural situations. 134. R U R A L S O C I A L P R O B L E M S A N D P U B L I C P O L I C Y . Fall term. Credit two hours. Open to graduate students. Prerequisite, permission of the instructor. T 2 -4 . Professor L a r s o n . This course relates the problem concept to a theoretical frame of reference, traces the development of social problems in American rural life, and examines the social aspects of selected current problems including levels of living, socio­ economic status groups, institutionalized facilities and services, population, and technological change. Public policies and action to meet these problems are de­ scribed and analyzed. 135. F A R M E R S ’ O R G A N I Z A T I O N S . Spring term. Credit three hours. Open to juniors, seniors, and graduate students. M W F 4:30. Warren 232. Professor A nderson. A study of the important farmers’ movements in the United States. The organ­ ization, programs, and policies of present state and national farmers’ organiza­ tions, and their relations to national agricultural policies and to extension pro­ grams. A D J U S T M E N T I N T H E M I D D L E A N D L A T E R Y E A R S (C H I L D D E V E L ­ O P M E N T A N D F A M I L Y R E L A T I O N S H I P S ) . Offered jointly by the Depart­ ments of Rural Sociology and Child Development and Family Relationships. This course may count as an elective in the College of Agriculture. Fall term. Credit three hours. T Th 11-12:30. Martha Van Rensselaer 121. Professor R o c k w o o d and Associate Professor Taietz. This course considers the adjustment in the middle and later years of life as a process of biological, psychological, and social change. Emphasis is placed upon changes in role and status, marital and family relationships, living arrangements, and employment. The provisions, public and private, that have been developed to meet the aged person’s economic, social, psychological, medical, recreational, edu­ cational, and housing needs are described and evaluated. [207. S O C I O L O G I C A L T H E O R Y . Fall term. Credit three hours. Alternates with course 208. Professor A n d e r s o n . ] Not given in 1953-54. A critical analysis of sociological theories from the time of Auguste Comte to contemporary sociologists. 208. S\ S T E M A T I C S O C I O L O G Y . Fall term. Credit three hours. Open to seniors and graduate students. Prerequisite, permission of instructor. T Th S 10. Warren 1 3 2 . Professor A n d e r s o n . This course presents a frame of reference for sociological thinking, with special emphasis on the interrelationships of the concepts in a system of sociology. .[211. T H E R U R A L C O M M U N I T Y Fall term. Credit two hours. Prerequisite, permission of the instructor. Associate Professor Reeder.] Not given in 1953-54! The community is analyzed with regard to its structure and functions in present- day society. A developmental analysis is made of contemporary rural communities in America and other countries. 212. R L R A L S O C I O L O G Y . Throughout the year. Fall term, credit three hours. M W F 9 . Spring term, credit two hours. T 2-4. Warren 31. Prerequistie, permission of the instructor or graduate standing. Professor Larson. A study of rural life in the United States, including population, patterns of making a living, group relationships, and the structure and functioning of insti­ tutionalized activities. These areas are considered from the standpoint of major trends and significant regional variations. A comprehensive review of the develop­ ment and content of rural sociology and of the points of view represented in the field. [217. S E M I N A R : T H E H I S T O R Y O F R E S E A R C H I N R U R A L S O C I O L ­ O G Y . Spring term. Credit three hours. Prerequisite, permission of the instructor. Professor Anderson.] A study of the development of research in rural sociology. Analysis of research methods, objectives, and results. .218. S E M I N A R : A P P L I C A T I O N S O F S O C I O L O G Y T O P R O B L E M S O F R U R A L S O C I E T Y Throughout the year. Credit two hours. Open to graduate students. M 2-4. Warren 232. Associate Professor Moe and members of the staff. Application of sociological information, theory, and methods to the programs of institutions and agencies concerned with rural life. Special emphasis is placed on the problems of communication and social change. 219. S E M I N A R : C O M M U N I T Y O R G A N I Z A T I O N . Spring term. Credit two hours. Prerequisite, permission of a department staff member. W 2-4. Warren 232. Professor Polson and members of the staff. Application of sociology to the problems of rural-community organization and community planning. 2 2 0 . S E M I N A R : C O M P A R A T I V E R U R A L S O C I A L L I F E . Fall term. Credit two hours. Open to seniors, special students, and graduate students. M 4 - 3 0 - 5 :5 0 and one session to be arranged. Warren 13 2 . Professor A n d e r s o n . A comparison of the ecological, economic, and social organization of rural life in foreign lands, including European, South American, Middle East, and Oriental countries, with consideration of major social problems. The specific countries to be studied are determined by student interest. [240. S E M I N A R : P R O B L E M S I N T E A C H I N G S O C I O L O G Y . Spring term. Credit two hours. Prerequisite, permission of instructor. Associate Professor Reeder and staff.] Not given in 1953-54. A consideration of the problems in teaching sociology in colleges and a study of some of the new approaches to teaching that are being tried in American uni­ versities. 250. I N F O R M A L S T U D Y I N R U R A L S O C I O L O G Y . Throughout the year. Credit to be arranged. Prerequisite, permission of the department staff member concerned. Professor Polson and members of the staff. 251. R E S E A R C H I N R U R A L S O C I O L O G Y . Throughout the year. Hours and credit to be arranged. Professor Polson and members of the staff. VEGETABLE CROPS Students planning to specialize to a greater or less extent in vegetable crops should consult the department regarding choice and sequence of courses. An out­ line of suggestions is available. 1. V E G E T A B L E C R O P S . Spring term. Credit four hours. Lectures, M W F 11. Plant Science 233. Laboratory M T W or F 2-4:30. Vegetable greenhouses and East Ithaca gardens. Professor Sweet. Intended for the student who wishes to specialize in commercial vegetable growing, whether the vegetables are for the fresh market or for processing. A study of the general principles of vegetable growing. Consideration is also given to the economic importance, cultural requirements, marketing, and storage of im­ portant vegetables. 2. P O T A T O P R O D U C T I O N A N D P R O C E S S I N G . Spring term. Credit three hours. Lectures, T Th 10. East Roberts 222. Laboratory, T or W 2-4:30. East Roberts 223. Professor Ora Smith. General principles and practical phases of potato production, storage, and processing are discussed. Growth processes and soil and environmental factors are emphasized as influencing production. Topics such as storage methods, grading, packaging, cooking quality, nutritive value, processing, and industrial uses of potatoes also are studied. Two field trips, one of which is all-day, are taken to potato farms and processing plants. 10. V E G E T A B L E J U D G I N G . Fall term. Not for credit. Intended to prepare students for participation in judging contests. M 4:30-6 or other time to be ar­ ranged if more suitable to group. East Roberts 2 2 3 . Professor Pratt. The course includes potato grading, identifying potato grade defects, and identi­ fying vegetable varieties, weeds, insects, and diseases, as well as judging vegetables. 12. P O S T - H A R V E S T H A N D L I N G O F V E G E T A B L E C R O P S . Fall term. Credit three hours. Lectures, T Th 11. East Roberts 222. Laboratory, T or W 2-4:30. East Roberts 223. Professor Hartman. Horticultural aspects of marketing vegetables; vocational opportunities in the field; methods of estimating and measuring quality and grade; research results and practices in packing, storing, transporting, and selling. One two-day and three afternoon trips required. Estimated partial cost of transportation to be collected from the student, $2. 112. H A N D L I N G V E G E T A B L E C R O P S , A D V A N C E D C O U R S E . Fall term. Credit four hours. Primarily for graduate students and those undergraduates who are specializing in marketing. Lectures, T Th 11. East Roberts 222. Laboratory, T or W 2-4:30. East Roberts 223. One-hour conference period, to be arranged. Professor Hartman. This course has the same lectures, laboratories, and field trips as course 12. Much more outside reading of research publications in the field is required in course 112 than in Course 12, and different examinations are given for the two courses. 101. V E G E T A B L E C R O P S , A D V A N C E D C O U R S E . Fall term. Credit four hours. Prerequsite, course 1 and Botany 31, Lectures, M W F 9. Laboratory, M 2-4:30. East Roberts 223. Associate Professor Jacob. A course devoted to a systematic study of the literature dealing with practices in vegetable production. Results of experiments that have been concluded or are being conducted are studied, and their application to the solution of practical problems is discussed. [113. K I N D S A N D V A R I E T I E S O F V E G E T A B L E S . Fall term. Credit three hours. Given in alternate years. Prerequisite, course 1 or permission to register. Associate Professor Carew.] Not given in 1953-54. Laboratory work preceding the beginning of regular instruction is required. This course involves a study of new and standard varieties of strains of vege­ tables, their origin, characteristics, adaptation, identification, and evaluation. The vegetable seed industry is also discussed. The main value of this course lies in the study of crops in the field. 225. R E S E A R C H M E T H O D S I N V E G E T A B L E C R O P S . Spring term. Credit four hours. Primarily for graduate students. Prerequisite, course 101. It is rec­ ommended that Botany 231 and 2 3 2 precede or accompany this course. Lectures, M W F 9. Laboratory, M 2 - 4 :3 0 . East Roberts 2 2 3 . Associate Professor K e l l y and Professor Jacob. A study of research techniques peculiar to vegetable crops, with a study of the literature and the solution of research problems. 231. U N D E R G R A D U A T E R E S E A R C H . Fall and spring terms. Credit one or more hours a term, by arrangement. For advanced undergraduate students. Regis­ tration by permission of the staff member who is to direct the research. Members of the staff. Special problems may be elected in any line of vegetable work. Summer resi­ dence is often necessary in connection with experimental problems. 232. S E M I N A R . Fall and spring terms. Required of graduate students taking either a major or minor in this Department. Th 4:15. East Roberts 222. Members of departmental staff. COURSES IN O TH ER COLLEGES T H A T M AY BE OFFERED TO MEET THE SPECIFIC REQUIREM ENTS OF REGULAR STUDENTS IN THE COLLEGE OF AGRICULTURE Reference should be made to the A n n o u n c e m e n t of the College of Arts a n d Sciences, or its supplements, for descriptions of English 111 and 112, Chemistry 101 and 102, or 105 and 106, Physics 103 and 104, Geology 115, and Zoology 103 and 104, which may be used to satisfy the requirements in those subjects, as listed on page 27. MILITARY SCIENCE AND PHYSICAL TRAINING The A n n o u n c e m e n t of the Indep end ent Divisions a n d D e p a r t m e n t s lists the courses that meet the University’s requirements in Military Science and Physical Training. General Information THE BUILDINGS T HE BU ILD IN G S erected under the enactment of 1904 were first oc­ cupied in June 1907. The central group then erected consisted of a main administrative and classroom building, Roberts Hall, connected by covered loggias with the Dairy Building, now East Roberts, on the east, and with Stone Hall, now occupied by the Department of Rural Educa­ tion, on the west. Subsequently, the Legislature provided for the erection of two large barns, a greenhouse range, a forestry building (Fernow H a ll), a poultry husbandry building (Rice H a ll), a soils building (Cald­ well H a ll), an auditorium, a classroom building (Wing H a ll), and a stock-judging building for animal husbandry, several small poultry buildings, a sheep barn, a swine barn, a farm shop and tool shed, and and insectary. There are, in addition, a fish-breeding house in Cascadilla Creek, a seed-storage house, a cold-storage and packing house, and other small buildings on the farms. In 1920 the State authorized the College to plan a further development of its building program involving an expendi­ ture of $3,000,000. Under this building program plan $500,000 was ap­ propriated in 1920 for a new dairy building, and in 1922 provision was made for its equipment. The building came into use in the fall of 1923. A further appropriation of similar amount was used for completing the Dairy Building, erecting an additional greenhouse range, moving and remodeling the Agricultural Engineering laboratories, and constructing the foundation for the Plant Science Building. The last-named building was completed under an appropriation of $1,100,000 made by the Legis­ lature of 1928, and occupancy began with the second term of 1930-31. The Legislature of 1930 provided $400,000 for the equipment of the Plant Science Building and appropriated $100,000 for additional barns and other smaller buildings for the Department of Animal husbandry. It also appropriated $100,000 for the construction of the foundation of a building for the Departments of Agricultural Economics and Rural Sociology, and to this sum the Legislature of 1931 added $500,000 for the completion of the building. The new barns for sheep, swine, and beef cattle were completed in 1931. The Departments of Agricultural Eco­ nomics and Rural Sociology occupied their new building, Warren Hall, in February, 1933. In 1934-35 the completion of a new home economics building, Martha Van Rensselaer Hall, made it possible to move the Department of Entomology into the building previously occupied by the College of Home Economics. The building is now named Comstock Hall. The horse barn and the sheep barn were destroyed by fire in 1938 and have subsequently been replaced. A new library for Agriculture and Home Economics was completed in 1952. LANDS FOR RESEARCH AND INSTRUCTION Cornell University owns or leases about 12,000 acres of land. O f this, approximately 7,500 acres are used by the several departments of the College of Agriculture. About 600 acres more are in wildlife preserves and field stations and are used jointly by several departments of the University. The type and amount of land assigned to each department varies according to its needs. Some departments, such as Agronomy, Plant Breeding, Floriculture and Ornamental Horticulture, and Vegetable Crops, need tillable land with certain types of soil on which to conduct field experiments. The Animal Husbandry Department needs large areas suitable for pasture and for the production of hay and corn for silage to feed experimental animals. The Department of Pomology has an area of about 100 acres that is used for orchard and small fruits, and the Department of Poultry Husbandry uses about the same acreage for poultry buildings and range. Arable land not immediately needed by the individual departments for research and instruction is operated by the Office of Farm Practice on an extensive basis. This office also acts as a service department, plow­ ing and fitting much of the land used by other departments for experi­ mental purposes. This system prevents the duplication of expensive machinery and uses the farm labor efficiently. The Departments of Ani­ mal Husbandry, Agronomy, and Plant Breeding, because they have such large areas under cultivation, own their own equipment. The tillable lands used by departments of the College comprise about 2,200 acres; about 465 acres more are in pasture. The remaining area used by the College consists of forest tracts and of lands used as wildlife preserves and field stations. The Department of Conservation alone operates almost 5,000 acres, of which the Arnot Forest, about twenty miles southwest of Ithaca and consisting of more than 4,000 acres, and the Adirondack Forest of 624 acres are the most extensive. The wildlife preserves and field stations include a biology field station at the head of Cayuga Lake, wildlife reservations at M cLean and Ringwood (each only a short distance from Ithaca), and a wildflower preserve at Slaterville. LIBRARIES The Colleges of Agriculture and Home Economics are served by the Albert R. Mann Library of about 200,000 volumes. This is supplemented by the other libraries of Cornell University, containing more than 1,000,000 volumes, many of which also relate directly to agricultural and home economics subjects. In addition to materials on applied agriculture and home economics, the Mann Library contains extensive collections dealing with such related sciences as botany, biochemistry, bacteriology, genetics, and entomology. It also includes large collections in economics, sociology, and education, and smaller collections on a variety of other subjects. O f major importance are the numerous complete files of foreign and domestic periodicals and government publications, of which some 5.000 are received currently. The library includes an outstanding collec­ tion on beekeeping maintained from funds provided in honor of the late Everett Franklin Phillips. The principal collection on entomology and limnology is in Comstock Hall, with the department it serves. Small departmental collections of reprints, bulletins, and duplicate books and journals for use of faculty and graduate students are also provided in several other buildings. The Albert R. Mann Library, completed in 1952, has a capacity of 400.000 volumes and 600 reading room seats. T he first floor is devoted primarily to books assigned for class reading, with rooms seating 300 persons. Also on this floor are rooms for typing and for small groups studying together, and the Ellis Room containing books and periodicals for informal reading. On the second floor are the reference, bibliography, and periodical reading rooms, offices, and work rooms, the main loan desk, and the card catalog. The catalog provides a record of the library materials in all libraries and departmental collections of the Colleges. The Library has a comprehensive collection of bibliographies, as well as a card catalog of publications of the United States Department of Agriculture. The Library is open, with librarians on duty to assist readers, from 7:50 a.m. to 10:00 p.m. daily except Saturday, when it closes at 5:00 p.m. Students may borrow most books, except those on reserve, for periods of two weeks. Detailed information on library regulations and suggestions for use of the Library are provided in a handbook distributed to all new students. SCHOLARSHIPS GENERAL SCHOLARSHIPS Students in the College of Agriculture are eligible to compete for certain scholarships that are available to all undergraduates in the U n i­ versity. Among these are the Cornell National Scholarships, the Univer­ sity Undergraduate Scholarships, and the George W. LeFevre Scholar­ ships. Residents of New York State are also eligible for the State Univer­ sity Scholarships. Those who reside in certain areas may apply for scholarships supported by the Cornell Alumni Clubs. Numerous other scholarships have various special limitations other than enrollment in a particular description school of all or college of the University. these scholarships are given in ScAhocloamrshpilpetsea nlidst Garnadntsa- in-Aid, a booklet that may be obtained by prospective students from the Director of Admissions or from Official Publication, and by students in residence from the Dean of Women or Dean of Men, in Edmund Ezra Day Hall. Prospective students who desire to become candidates for any of these scholarships should get this booklet early in the final year of secondary school, to be certain that their applications are on file at the proper time and that they make the necessary arrangements to take the required tests. Of special interest are the State University Scholarships mentioned above, five of which are awarded each county annually for each assembly district therein. Each of these scholarships entitles the holder to $350 for eaCaapcshehriySoedcahroofwlafhrosiulheriphysee, atirsos.adtAitsettniCndgionurginsehallntthahepemypraforrvoeemdcoctmohlmeleoSgnetalyitnektnThouiwsitiSaotsnattehSecdhuSortlaiantrge­ ships in this University. They are awarded by the State Commissioner of Education at Albany, to whom application should be made for any information about the conditions of award, or any information about the rules of administration. SCH O LA RSH IPS AW ARDED BY T H E CO LLEG E O F A G R IC U L T U R E SEARS, ROEBUCK SCHOLARSHIPS The Sears, Roebuck Agricultural Foundation has provided fifteen scholarships for farm-reared freshmen entering in 1953-54. T he value of each scholarship is $200. The awards are made on the basis of financial need and of scholastic promise in the field of agriculture. A scholarship of $200 is available for an outstanding sophomore who held one of these scholarships in his freshman year. Applications are to be addressed to the Office of Resident Instruction, Roberts Hall, Ithaca, New York, and must be completed by July 15. NEW YORK STATE BANKERS ASSOCIATION SCHOLARSHIP A scholarship of $200 is offered for 1953-54 by the New York State Bankers Association to a young man who has been a 4-H Club member and who is recommended by his 4-H Club agent. It is awarded for the freshman year on the basis of financial need, scholarship, and the promise of service to agriculture. The 4-H Club agent in each county of New York State may recommend one candidate to whom he will forward an application form. Applications must be on file in the Office of Resident Instruction, Roberts Hall, Ithaca, New York, by July 15. THE CARL E. LADD MEMORIAL SCHOLARSHIPS A fund in memory of Carl E. Ladd, Dean of the College from 1932 until his death in 1943, provides scholarships with an annual value of $200 each. These scholarships are open to young men and women from New York farms who are members of any class in the College of Agri­ culture. The awards are made on the basis of financial need, promise for future leadership, and school record. Applications are to be sent to the Office of Resident Instruction, Roberts Hall, Ithaca, New York, by July 15. Sixteen scholarships are available for the academic year 1953-54. GEORGE LAMONT EDUCATIONAL FUND The George LaMont Educational Fund was established by gifts from George B. LaM ont and his son T. E. LaM ont, owners of the LaM ont Fruit farm in Albion, Orleans County, N ew York. The income from the fund provides scholarships for Orleans County farm boys of good moral character who have a record in school and out that shows ability and application and who are in need of financial assistance. Awards are for one year and usually are made only to boys entering college. One or two scholarships of $200 each are available for the academic year 1953-54. Application blanks are distributed by the principals and teachers of vocational agriculture in Orleans County high schools. The completed application and the supporting form are to be addressed to the Office of Resident Instruction, Roberts Hall, Ithaca, New York. Both must be received by July 15. THE ROBERTS SCHOLARSHIPS The Roberts Scholarship Fund, a gift of the late Dr. Charles H. Roberts, of Oakes, Ulster County, New York, provides five scholarships, each retainable for one year, but not open to newly entering students. As expressed by the founder, the purpose of these scholarships is to fur­ nish financial assistance to students in the College of Agriculture who are of good moral character, who show native ability, tact, and application, and who are in need of such assistance, especially students coming from rural districts. The awards are made after the close of each year. Appli­ cation blanks and copies of the regulations may be obtained at the office of the Secretary of the College of Agriculture. All applications must be on the official blanks, which, with all other information, must be filed at the Office of Resident Instruction of the College by June 1. The present value of each scholarship is $250. BORDEN AGRICULTURAL SCHOLARSHIP AWARD The Borden Company has established an annual scholarship award to recognize and assist outstanding students who give promise of future achievement. It is awarded to the student of the College of Agriculture who has taken at least two courses in dairying and who, upon entering his senior year, has the highest average grade for all of his previous college work of any of the similarly eligible students. The value is $300 payable upon registration in the College for the senior year. An annual award of $100 is made possible through a grant from the W. Atlee Burpee Company, Seed Growers, Philadelphia, Pennsylvania, and Clinton, Iowa. The purpose of this award is to encourage outstand­ ing students in the study of vegetable growing and flower growing. It is to be awarded at the beginning of the senior year and is to be divided equally between two students, one in the field of floriculture and orna­ mental horticulture, the other in vegetable crop production. To be eli­ gible, the student shall have completed Botany 31 or its equivalent and at least two courses in the Department concerned, and shall have signified intention of specializing in that Department. HERVEY S. HALL SCHOLARSHIP The Hervey S. Hall Scholarship, established by bequest of Miss Mary F. Hall, of Spencer, New York, and having an annual value of $120, is to be awarded to a properly qualified student of either sex, a resident of New York, pursuing a course in agriculture leading to the degree of Bachelor of Science, and in need of financial aid. It is “to be granted first to a student from the town of Spencer, New York, should a suitable can­ didate appear, or to a student from Tioga County, or from the State at large.” Application for this scholarship should be made at the Office of Resident Instruction by June 1. THE ROBERT M. ADAMS 4-H MEMORIAL SCHOLARSHIP The Robert M. Adams 4-H Memorial Scholarship was established in honor of Professor R. M. Adams by the 4-H Clubs of the State. The scholarship yields approximately $50 a year. Students who are N ew York residents are eligible to apply after their first year in the College, and those who have been 4-H Club members are given first consideration. The award is based on financial need, character, ability, and scholarship. Application for this scholarship should be made at the Office of Resident Instruction by June 1. A. R. BRAND SCHOLARSHIP IN ORNITHOLOGY The A. R. Brand Scholarship in Ornithology was established to aid juniors, seniors, and graduate students specializing in ornithology who have demonstrated ability and initiative. Need is considered. The annual value of this award is approximately $300, Applications should be made to Associate Professor P. P. Kellogg in Ornithology, at the College. SWCOHMOALNAR’SSNHAIPTSIONAL FARM AND GARDEN ASSOCIATION The New York State Division of this Association has provided the folAlowscinhgolatwrsohipschinolahrosnhoiprs:of its first president, Mrs. Francis King. The value of the scholarship is $500, payable over a two-year period. The award is made biennially to a woman of the sophomore class in the College of Agriculture. Character, interest in agriculture, scholarship, and financial need are considered. Applications should be sent to the Office of ReAsidsecnhtoIlanrssthruipctiionn,reRcoobgenrittsioHn aollf, Iittshahcoan, oNraewry Yporreksi,dbeenfto, reMJrus.ly W15a.lter Douglas. Junior or senior women in the College of Agriculture who have achieved high standing are eligible to apply for the award of $200. Char­ acter and financial need are considered, with preference given to girls who have been active in a 4-H Club. Application should be made at the Office of Resident Instruction by June 1. ESSO 4-H SCHOLARSHIP T he Esso Standard Oil Company has established four-year scholarships of $100 a year to be awarded, two each year, to students entering the College of Agriculture. T he awards are made, on the basis of merit, ability, and need, to boys who have satisfactorily completed at least three years of 4-H Club work including the preceding year, and who graduate from high school with a scholastic standing in the upper half of the class. The recipient receives $100 each year for four years, provided he remains in college and maintains a satisfactory record. Application blanks may be obtained from the 4-H Club agent in each county. Applications must be on file in the Office of Resident Instruction, Roberts Hall, Ithaca, N ew York, July 15. WARD W. STEVENS HOLSTEIN SCHOLARSHIP A fund in honor of Ward W. Stevens provides a scholarship to a male undergraduate student in either the two-year or the four-year course in the College of Agriculture, who has completed at least one-half of his course. T he value of the scholarship in 1953-54 is $500. It may be awarded to one student or divided between two students. A student who has held the scholarship is eligible to reapply. The award is based on exceptional ability in the judging and handling of dairy cattle, high scholastic rank in dairy husbandry courses, need of financial assistance, and special interest in the Holstein breed of cattle. Applications should be received in the Office of Resident Instruction, Roberts Hall, Ithaca, New York, by June 1. BEATTY AGRICULTURAL SCHOLARSHIP The Beatty Agricultural Scholarship fund, a gift of the late Harrison L. Beatty, provides a scholarship of approximately $200 to a student en­ tering the College of Agriculture from the Town of Bainbridge or from Chenango County. Grades in Regents examinations receive major con­ sideration in making the award. Application blanks may be obtained from principals in Chenango County schools and must be sent to the Office of Resident Instruction, Roberts Hall, Ithaca, N ew York, by July 15. The Dairy Marketing Research Fund has established a scholarship with an annual value of $400. A candidate, to be eligible for an award, must have completed the work of the junior year and attained a cumulative average in all of his courses of 78 or above. In addition, he must have passed at least one course in each of dairy industry, dairy marketing, and dairy husbandry or farm management, except that no more than one of the named courses may be included in the schedule for the senior year. Consideration is also given to financial need, character, personality, and potential qualifications for contributing to improved relationships and techniques in the marketing of milk or the manufacture of dairy products. Application for the scholarship should be made on official forms and filed with all supporting information in the Office of Resident Instruction by June 1. NFREEWEZYEORRSKASSTSAOTCEIACTAINONNE, RISNCAONRDPORATED, SCHOLARSHIP An annual scholarship of $200 is provided by the New York State Canners and Freezers Association, Incorporated. It is awarded to a stu­ dent who is a resident of New York State, has two years of credit toward graduation, and gives evidence of preparing for a career in the process­ ing of fruits and vegetables. In making the selection, the Committee on Scholarships takes into consideration scholastic record, financial need, leadership ability, and other desirable qualifications. Applications should be filed in the Office of Resident Instruction by June 1. THE HEATLEY GREEN SCHOLARSHIP The Heatley Green Scholarship Endowment was established under the will of Mrs. Green in memory of her husband, who had been a New York State farm boy and was a graduate of the College of Engineering at Cornell in the class of 1901. Mr. Green had believed strongly in proper training for successful farming, and this scholarship is to be used to help and encourage worthy undergraduate students of moderate means. The value of the scholarship for 1953-54 is $800. Awards are made on an annual basis and may be to one student or divided between two or more students of any class in the College of Agriculture. Applications must be filed at the Office of Resident Instruction, Roberts Hall, Ithaca, New York, by July 15. SCHOLARSHIPS FOR NONRESIDENTS Fifteen tuition scholarships are available for nonresidents of the State. They are awarded annually, and evidence of need is required. Applica­ tions should be filed in the Office of Resident Instruction, Roberts Hall, Ithaca, New York, by July 15. A description of other scholarships open under certain conditions to Sucnhdoelragrrsahdipusataens dinGrtahnetsC-ino-llAeigde. of Agriculture is found in the booklet PRIZES T H E EASTM AN PRIZES FO R PUBLIC SPEAKING With the object of developing qualities of personal leadership in rural affairs, Mr. A. R. Eastman of Waterville, New York, established annual prizes, the first of $100 and the second of $25, for public speaking on country life subjects. These prizes are designated the Eastman Prizes for Public Speaking. Competition is open to any regular or special student in the College of Agriculture. The contest takes place usually during Farm and Home Week. THE RICE DEBATE STAGE T o stimulate the study and public discussion of vital farm life prob­ lems, Professor James E. Rice, Professor of Poultry Husbandry, Emeritus, has established annual prizes, the first of $100 and the second of $25. The contest is in the form of a debate. Preliminary trials are held in D e­ cember, on a subject to be announced. The final competition is held usu­ ally in Farm and Home Week. All regular or special students are eligible. TH E PAUL H. G U LD IN M EM O RIAL ENDO W M EN T The Paul H. Guldin Memorial Endowment, established by Mrs. Paul H. Guldin as a memorial to her husband, a graduate of the College in 1912, is to encourage undergraduate students in the College of Agricul­ ture to become interested, and to take part, in the development of a more adequate rural leadership. The income supports a contest in 1953- 54 the for the best original articles or College and published in the Cstoorrnieesl,l wCroiuttnentrybmyanun, dtehragtracdounatrtiebsuitne to the purpose of the endowment. The contest includes all issues of the magazine for the academic year. Tw o first prizes of $50 each and four second prizes of $25 each are available. Award will be made, not later than June 1, 1954, by a committee from the Faculty, appointed by the Dean. T H E RIN G M EM O RIA L PRIZES A bequest of Mr. Charles A. Ring, of Niagara County, New York, has established prizes to be awarded to undergraduate students in agriculture who, in essays giving reviews of the literature on problems in floriculture, vegetable gardening, or pomology, show the greatest ability to evaluate scientific evidence. The prizes for 1953-54 include first, second, and third place awards of $40, $20, and $10 each. The contest is open to students who have taken or are taking courses in the horticultural departments. The essays must be submitted to the Secretary of the Faculty of Agricul­ ture by noon on May 1. TH E CHARLES LA TH RO P PACK FO U N D A TIO N FO RESTRY PRIZE The Charles Lathrop Pack Foundation Forestry Prize is in the amount of $40 and is awarded annually in April for the best essay on forestry submitted by a resident student who has taken some course in for­ estry during the current college year. The purpose of the prize is to aid in training men and women to write articles that will arouse in the public an interest in forestry and an appreciation of what forestry means to the country. The award is made by a committee appointed by the President of the University. The detailed regulations are furnished by the Depart­ ment of Conservation or by the Secretary of the College. The essay must be deposited at the office at the head of the Department of Conservation by noon on April 15. ALUM NI PRIZE The Alumni Association of the College of Agriculture contributes an annual prize of $25 to be awarded at the close of the junior year to the student who has maintained the best scholastic record during his three years in the University, the award to be made by the Faculty of the College. ALPHA ZETA CUP The Alpha Zeta fraternity has presented a prize cup to be awarded for custody for one year to the male student in the College of Agriculture making the best scholastic record during the freshman year. For students first admitted in the second term, the average of three terms' work is con­ sidered. Presentation of the cup is made at the opening of the fall term. O T H E R PRIZES Information concerning other prizes offered in the University and open to competition special booklet ocfalslteuddePnrtsizeinCtohme pCeotiltlieognes,ofwAhigcrhicumltauyrebies given in obtained the by writing to Cornell University Official Publication, Edmund Ezra Day Hall, Ithaca, New York. LOANS The New York State Grange has established a loan fund to aid its members in obtaining a higher education. Applications may be made to Mr. H. M. Stanley, Skaneateles, New York. A fund contributed by students of the College is available for small, short-time, emergency loans. Application may be made to the College Secretary. A fund, the interest on which is available for loans to students spe­ cializing in flloriculture, has been established by Mr. M ax Schling of New York City. Another loan fund for students of floriculture, with principal and interest available, has been contributed by the New York Florists Club. Applications for loans from both these funds may be made to the College Secretary. Notice of other loan University, is found in tfhuendbso,oakvleatilSabchleoltaorsshtiupdsenantsd oGf raalnl tcso-ilnle-gAeisd.in the HEALTH SERVICES AND MEDICAL CARE These services are centered in the University Clinic or out-patient de­ partment and in the Cornell Infirmary or hospital. Students are entitled to unlimited visits at the Clinic; laboratory and X-ray examinations indi­ cated for diagnosis and treatment; hospitalization in the infirmary with medical care for a maximum of fourteen days each term and emergency surgical care. The cost for these services is included in the College and Usenrviviceerss,itsyeegetnheeraGlenfeeer.alFoInrfofurrmthaetirondebtaoiolsk,leitn. cluding charges for special A dm inistration (R ural E ducation), 90 Admission of regular students, 21; with advanced standing, 24; of special students, 24 A gricultural Economics, 37 A gricultural Education, 88 A gricultural Engineering, 43 A g ric u ltu ral G eography, 41 A g ric u ltu ral O ccupations, 16 A gricultural Policy, 41 Agronomy, 45 A nim al B reeding, 51 Animal Husbandry, 49 Anim al N utrition, 52 Apiculture, 68 Bacteriology, 53 Beekeeping, 68 Biochemistry, 54 Biology, 65 Biom etry, 78 B oard, 35 Botany, 56 Buildings, 98 Business M anagem ent, 38 C alendar, inside front cover C om bined courses, 30 Professional A gricultural Engineering, 30 Business and Public A d m in istratio n , 31 School of N u tritio n , 32 V eterinary College, 32 Conservation, 58 Conservation E ducation, 85 Council M embers, 3 Courses in o th er colleges, 97 Courses open to freshm en, 29 Curriculum and Secondary Education, 90 D airy H u sb an d ry , 51 D airy Industry, 62 D egree, req u irem en ts for, 25 D egree w ith D istinction, 28 Draw ing, 64 E ducation, G eneral, 91 E ducational Psychology, 86 Em eritus Professors, 3 Entom ology and Limnology, 65 Entom ology, Econom ic, 67 E n tra n ce requirem ents, 22 Expenses, 34 E xtension E d u ca tio n , 87 Extension O rganization and M ethods, 72 E xtension T ea ch in g , 70 Faculty Representatives, 2 Farm A ppraisal, 42 Farm Finance, 42 F a rm M a n a g em en t, 37 Farm s, 99 Fees, 34 Field Crops, 48 F lo ricu ltu re, 72 Floriculture, C om m ercial, 74 Food Science and Technology, 75 Forestry, 59 F ou r-y ear course, th e, 16 G enetics (P lan t B reeding), 77 Genetics and Anatomy (Poultry H u sb an d ry ), 83 G raduation, 27 G uidance and Personnel, 90 H ealth Services and M edical C are, 108 Herpetology, 59 Ichthyology, 59, 60, 62 Incubation and Embryology, 84 Insect M orphology, 66 Insect Physiology, 69 Insect Taxonom y, 66 Insect Toxicology, 69 Jo u rn a lism , 71 L an d Econom ics, 41 L andscape Service, 75 Libraries, 99 Limnology, 69 Livestock Production, 49 Loans, 107 M ammalogy, 59 M arketing, 39 M eats, 50 M eteorology, 76 M ilitary Science, 97 M iscellaneous rules and assessments, 35 N ature Study, 85 N ursery M anagem ent, 74 N u tritio n , 54, 83 Oceanography, 61 Registration, 29 O ral and W ritten Expression, 70 R equired courses, 27 O rientation, 37 Residential Halls, 35 O rnam ental H orticulture, 72 Rooms, 35 Ornithology, 59 Rural Education, 84 Parasitology and M edical Entomology, 68 R ural Sociology, 92 Physical T raining, 97 Scholarships, 100 Physiology of Reproduction, 51 Science Education, 85 P lant Breeding, 78 Soil Science, 45 P lant M aterials, 73 Staff, 5 Plant Pathology, 79 Statistics and Biometry, 78 Pomology, 81 Supervision (R u ral E d u catio n), 89 Poultry H usbandry, 82 Trustees, 2 Practice R equirem ent, 25 T uition, 33 Prices, 38 Vegetable Crops, 95 Prizes, 106 Visual Aids, 72 Public Adm inistration and Finance, 39 Wildlife, 58 R adio, 71 Zoology, 60