CORNELL UNIVERSITY ANNOUNCEMENTS VETERINARY COOctLoLbeErG2E9,1962 NEW YORK STATE VETERINARY COLLEGE AT CORNELL UNIVERSITY, A UNIT OF THE STATE UNIVERSITY OF NEW YORK ACADEMIC CALENDAR (Tentative) 1962-1963 1963-1964 Sept. 15. . . . S.................Freshman Orientation (not required of Sept. 2 1 . . . . S entering Veterinary students) Sept......17...M .................Registration, new students...........................................Sept. 23 . . . M Sept. 1 8 . . . . T .................Registration, old students............................................. Sept. 2 4 . . . . T Sept. 19. . . W .................Instruction begins, 1 p.m...............................................Sept. 25. . . W Nov. 7 . . . . W .................Midterm grades due........................................................Nov. 13. . . W Thanksgiving recess: Nov. Nov. 21. 26. . . . W M ......... ......... .........I n s t r u c t i o n .........Instruction suspended, resumed, 8 12:50 p.m ................. a .m .............................. ...........Nov. 27. . AV M Dec. 19. . . .W .........Christmas recess.................................................... Instruction suspended at 10 p.m. S in 1962, at 12:50 p.m. in 1963 Jan. Jan. 3 ... 19.. Th ...S ........ ......... .........Instruction .........First-term resumed, instruction 8 a.m.............................. e n d s ............................... ...........J a n . ...........J a n . 6 ... 25.. M S Jan. Jan. 21.. 22.. . .M . .T ......... ......... ........ Second-term registration, old students........... .........Examinations begin.............................................. ...........J a n . 27.. ..M ..T Jan. Jan. Feb. Feb. Feb. 30.. . .W ......... ........ Examinations en d................................................ ...........Feb. 31.. .T h ......... .........Midyear recess........................................................ ...........Feb. 1. . . 2 ... 4. . . .. .. .. .F .S M ......... ......... ........ .........Midyear recess......................................................... .........Registration, new students............................... .........Second-term instruction begins..................... ...........Feb. .......... Feb. ...........Feb. 5 ... 6 ... 7 ... 8. .. 10.. W .T h F S .M Mar. 22. ...........Mar. 27. . . F Spring recess: Mar. Apr. May May June June 23. . . .S ......... 1. . . . M ........ 25.. 27.. .. . .S M ........ ........ 4 . . . . . T ......... 10. . M ........ ........ Instruction suspended, 12:50 p.m ................. ........ Instruction resumed, 8 a.m............................. ..........EExxaammiinnaattiioonnss beengdin.......................................................................... Commencement D a y ................................. .......... Mar. ............M ay 28. 30.. ...S M S . .M T .M C O R N E L L U N IV E R S IT Y A N N O U N C E M E N T S . Volume 54. Number 9. Octo­ ber 29, 1962. Published twenty times a year: twice in March, April, May, June, July, August, October, December; three times in September; once in November; no issues in January or February. Published by Cornell University at Edmund EItzhraacaD, aNyeHwaYllo, rk18. East Avenue, Ithaca, New York. Second-class postage paid at CORNELL UNIVERSITY ANNOUNCEMENTS Supplement to Volume 54, Number 9, October 29, 1962 VETERINARY COLLEGE On page 36, under the Department of Physical Biology, the following course should be added: 108. BIOLOGICAL MEMBRANES AND NUTRIENT TRANSFER. Spring term. Credit two hours. Lectures (times to be designated). Prere­ quisites, animal or plant physiology, quantitative and organic chemistry, physics, and consent of instructor. Cellular physiology and elementary physical chemistry desirable. Associate Professor Wasserman. Lectures and demonstrations on biophysical properties of biological membranes, theoretical aspects of permeability and transport, and mechan­ ism of transfer of inorganic and organic substances across intestine, placenta, kidney, erythrocytes, bacteria, and other biological systems. (Not given in 1963 but offered in 1964.) NEW YORK STATE VETERINARY COLLEGE AT CORNELL UNIVERSITY 1962-1963 TIshae CVoentetrriancatrUy nCitololfegteheatStCaoternUelnlivUernsiivteyrsoitfy New York CONTENTS ACADEMIC CALENDAR Inside front cover TRUSTEES ........................................................................................................ I COUNCIL .......................................................................................................... 2 FACULTY, STAFF, AND SPECIAL L E C TU R ER S............................ 3 COLLEGE BUILDINGS AND RESEARCH FACILITIES 9 ADMISSION AND ENTRANCE R EQ U IR EM EN TS........................ 12 EX PE N SE S.......................................................................................................... 21 FINANCIAL A ID S........................................................................................... 23 H EA LTH SERVICES AND MEDICAL C A R E..................................... 28 HOUSING FOR STU D EN TS..................................................................... 28 T H E CONDUCT OF STU D EN TS........................................................... 30 REQ UIREM ENTS FOR GRAD UATION (D.V.M. DEGREE). ... 31 DESCRIPTION OF COURSES................................................................... 33 CAREERS FOR V ETERIN A RIA N S......................................................... 47 LEGAL REQ UIREM ENTS FOR PR A C T IC E ..................................... 50 S T U D E N T S ........................................................................................................ 51 INDEX ................................................................................................................. 56 LIST OF A N N O U N CEM EN TS..........................................Inside back cover view of the Veterinary College. ill CORNELL UNIVERSITY BOARD OF TRUSTEES Arthur H. Dean, Chairman JMWJJFMLJHHLSAJJJJHWDKooao.oouroeooumsaoeaehaaahhhariluPerrsirrrlonlnonnnenntaloipkybttrmhyakissiicelehaennlELMdSesJordmHrEHRSSt....tnFoH...PLC..C.KoDM.CnMF.C.C.L.A.ClMDGineoClcCsCoilFaKLalaiHlitakMorlactllrgntdilaeeurryuitrlnHsaahvykdpitnieJlamlemlnchnnieitowule,osrnskieieorHmtbrhgngnJoorezvunhrawg*rooae.s*sne*lndorolrionsdte*r TAGSSCRFNAFMJREDBWMJFIJarophhorrealorlelruovnreabhabeeefhoiuotlsbdninldsrhlsnenrden.crmnleceeomocgriecreedogJWnratitlnHeeMarrP.tsaflmiirWsm.PKnncM.SNi.WWAABHlT..e.ESl.oRA.O.C..iPW.WT.i.y.yaMcWJ..hNSelmSeRmPu.OMkiSoeiWarWsncieleuhtioricdt,pslPhdtwg*icrhaicPoeleloilnegcJhhemlkemes.nbrorireeeetsesms*u.dRl*rstltifolzrolnaeaoynngtlngtlieeu*errsr*s Deane W. Malott, President of Cornell University* STATE UNIVERSITY OF NEW YORK BOARD OF TRUSTEES WMCJFGBLarehoemraasysaonrt.redrerklgseBreeEnsCeGB.tW.GW.trGyeMaG.e.orHnoGrslCadiooadlnleruewueegragt,lesehenr,CyeJhrDra.iornmnaenlly SMCMDJJoaalorommihsfnrn.teruoisJeJsnA.ol J.hWI.WHunRWsi.achouAPkaeos.rwhhsmreaaWeivmtlanzeenanlrt n e r Thomas H. Hamilton, President of the State University * Trustee ex officio. 1 COUNCIL, NEW YORK STATE VETERINARY COLLEGE WDilliiraemctoEr., JMenenaitngIsn,sDpe.Vct.iMon., CSheraviircme,anN.Y. State D epartm ent of Agri­ culture and Markets JohDnireDc.toHr,ecTk,hVe .MAn.Dim. al Medical Center, New York City HaDroirledctLo.r,CNreeawl, YBo.Sr.k State Fair HeDnirryecDtoorr,emDuesp,aDrt.mVe.Mnt., oMf .SA.,niPmha.Dl . Care, Medical College, Lhiiversity of Vermont HaHrreUyadnF,iveeDldresmiptayanrto,mfMeNn.eDtw.ofYoPrukb, lUicpsHtaetaeltMh eadnicdalPCreevnetnetrive Medicine, State CliGffeonredraHl .PHraocptipteionnseterdt, D.V.M. HoDwimraerecdntotWr,o.fAJAnoighmrniasclounlDt,uisrDee.aVse.Ma.n,dMP.Sa.rasite Research Division, U.S. D epart­ ThPormeUsanisdiveEenr.ts,iMtyNileliwmaYn,orBk.S.State Agricultural Society; Trustee, Cornell Albert K. Mitchell, B.S. Memmitbteeer,; TUr.Su.steDee, pCarotrmneelnlt UonfivAergsriitcyulture, National Advisory Com­ KaErlxReRceu.setRiavreecihnShGeacrrrdae,ntatDsr,y.V,N.MGate.i,onneParhal.lDI.nMsteitduitceisneofSHtuedaylthSection, Division of JohGnenRer.alStPeerlaec,tiDtio.Vn.eMr . Bernard F. Trum , D.V.M. Director, The Animal Research Center, Harvard Medical School Bruce W. Widger, D.V.M. General Practitioner; Trustee, Cornell University 2 FACULTY M a lo ti', D e a n e W ., A .B., M .B.A ., LL.D., D.C.S., P resid en t of the U niversity. P o ppen siek , G eorge C., V .M .D., M.S., Professor of M icrobiology and D ean of th e C ollege. Ste ph en so n , H adley C., B.S., D.V.M ., Professor of Veterinary T herapeutics and Small Anim al Diseases, Emeritus. H agan, W illia m A., D.V.M ., M.S., D.Sc., LL.D., Professor of Veterinary Bacteri­ ology, Emeritus, and former Dean of the College. D ukes, H enry H ., B.S., D.V.M ., M.S., D .H .C ., Professor of Veterinary Physiology, E m eritu s. D y e, J oseph A., A.B., Ph.D., Professor of Physiology, Emeritus. G ilm a n , H erbert L., D.V.M ., M.S., Ph.D ., Professor of Veterinary Bacteriology, E m eritu s. A llf.n, R osanna P., A.B.. B.S. (Lib. Serv.), Associate Librarian. A ngstrom , C lem en t I., D.V.M ., Director of Laboratory, Poultry Disease Pro­ gram (Kingston). B aker, D onald W ., B.S.A., D.V.M ., Ph.D., Professor of Veterinary Parasitology. B ak er, Jam es A„ B.S., M.S., D.V.M ., Ph.D ., Professor of Veterinary Virology and Director of the Veterinary Virus Research Institute. B arrett, R obert B., B.A., D.V.M ., Assistant Professor of R adiology. B a r th o lo m ew , R ichard C., D.V .M ., M edical Interne in the D epartm ent of M ed­ icine and Obstetrics. B eck, A lbert M., B.S., D.V.M ., Assistant Professor of Small A nim al M edicine. B en so n, T ho m a s F., B .S., D.V.M ., M.S., Director o f the D iagnostic Laboratory. B en tin ck-Sm it h , J o h n , A.B., D.V.M ., Professor of Pathology. B ergm an, E m m et t N ., B.S., M.S., D.V.M ., Ph.D., Associate Professor of Physiology. B oyd, J am es W ., D.V.M ., Acting Assistant Professor in the D epartm ent of Physi­ ology. B o y er , C lyde I., J r ., V .M .D ., M .S., Professor of A vian Diseases. B row n, H arold L., D.V.M ., Field Veterinarian, M astitis Program (Earlville). *B runer, D orsey W „ B.S., D.V.M ., Ph.D., Professor of Veterinary Bacteriology. C a ln ek , B ruce W ., D.V.M ., M.S., Associate Professor of A vian Diseases. C a m pb e ll, Sa m u el G., M.V.Sc., B.V.M .S., M .R.C.V.S., Assistant in Veterinary Bacteriology. C a r m ich a el, L eland E., A.B., D.V.M ., Ph.D., Research Associate in the D epart­ m ent of Pathology and Bacteriology. C hen ey , John B., D.V.M ., Field V eterinarian, M astitis Program (Canton). C oggins, L eR oy, B.S., M.S., D.V.M ., Research Associate, Research Laboratory for Diseases of Dogs. C om ar, C yril L., B.S., Ph.D., Professor of Physical Biology and H ead of the Departm ent of Physical Biology. C om bs, J ohn P., D.V.M ., Surgical Interne in the D epartm ent of Surgery. * Acting head, Dept, of Pathology and Bacteriology, 1962-1963. 3 1 VETERINARY COLLEGE, CORNELL C o t c h in , E rnest, D.Sc., M .R.C.V.S., V isiting Professor of Pathology a n d Bac­ teriology. D anks, A rthur G., B.S., D.V.M ., Professor of Veterinary Surgery and Director of Student Administration. D avis, T ho m a s F,., D.V.M ., M edical Interne in th e D epartm ent of M edicine and O b stetrics. de B o o m , H en ri P. A., B.V.Sc., V isitin g Professor of Veterinary Anatom y. D ela h a n ty , D onald D ., D.V.M ., M.S., Professor of V eterinary Surgery, H ead of the Departm ent of Surgery, and Director of the Large Anim al Hospital. de L a h u n ta , A lexander. D.V.M ., Instructor in Veterinary Anatom y. D en n is, Stanley M., B.V.Sc., Ph.D ., V isiting Professor in the D epartm ent of Pathology and Bacteriology. D ou gherty, E llsw o rth, III, B.S., V.M .D., Director of Laboratory, T urkey and Duck Program (Eastport). D u n lo p, R obert H ., B.S., D.V.M ., Ph.D., Associate Professor of Veterinary P harm acology. D unn, H enry O., B.S., M.S., Ph.D.. Research B iologist in the D epartm ent of Pathology and Bacteriology. E vans, H ow ard E., B.S., Ph.D ., Professor of Veterinary A natom y and Secre­ tary of the College. F abricant, J u lius, B.S., V .M .D., M.S., Ph.D ., Professor of A vian Diseases. F ield, L incoln E., D.V.M ., Field V eterinarian (Ithaca). F in ch er, M yron G., D.V.M ., M.S., Professor of Veterinary M edicine, H ead of the D epartm ent of M edicine and Obstetrics, and Director of the Ambulatory Clinic. F ouad, M o h am ed T . A., B.V.Sc., M.Sc., Assistant in the V eterinary Virus R e­ search Institute. Fox, F rancis H ., D.V.M ., Professor of Veterinary M edicine and Obstetrics. G asteiger, E. L., Jr., A.B., M.S., Ph.D ., Professor of Physical Biology. G eorgi, J ay R., D.V.M ., Research Associate in Physical Biology. G iatta s, C h r isto ph e r S., D iplom a V eterinary M edicine, V isiting F ellow in the Departm ent of Veterinary Physiology. G illespie, J ames H ., V.M .D., Professor of Veterinary Bacteriology and Assistant Director of the Cornell Research Laboratory for Diseases of Dogs. G iordano, A nthony R obert, B.A., D.V.M ., Research Specialist in the D epart­ m ent of Avian Diseases. G lazer, R ichard B., B.S., M.S., Assistant in the D epartm ent of Pathology and B a cterio lo g y. G u t h r ie, R ichard S., D.V.M ., Supervising V eterinarian, M astitis Program (Ithaca) . H a bel, R obert E., D.V.M ., M.Sc., M .V.D., Professor of Veterinary A natom y and Head of the Departm ent of Anatomy. H agan, J ean R., D.V.M ., Director of Laboratory, Poultry Disease Program (O neonta). H err, P atricia T ., D.V.M ., M edical Interne in the D epartm ent of Small Anim al M edicine and Surgery. H ilbert, K en n eth F., D.V.M ., D irector o f Laboratory, Poultry Disease Program (Farm ingdale). H illm a n , R obert B., B.A., D.V.M ., M .S., Assistant Professor of Veterinary M edicine and Obstetrics. FACULTY AND STAFF 5 H iltz, F rederick L., S.B.E.E., S.M.E.E., Research Assistant in the D epartm ent of Physical Biology. H im es, Jam es A., B.S., D.V.M ., Assistant in th e D epartm ent of Physiology. H su, C e c ilia S. L., B.S., M.S., Assistant in the D epartm ent of Pathology and B a cterio lo g y. H w ang, J en , D.V.M ., M.S., Ph.D., D uck Disease Specialist (Eastport). I chikaw a, Santa, M .D., Ph.D., Visiting Professor in the Departm ent of Physical B io lo gy . J ohnson, Seth D., D.V.M ., Field Veterinarian, M astitis Program (Ithaca). K ahrs, R obert F., D.V.M ., Research Associate, D epartm ent of Pathology and Bacteriology. K a llfelz, F rancis A., D.V.M ., Research Assistant in the D epartm ent of Physical Biology. K eh o e, J oh n M., D.V.M ., Assistant in the D epartm ent of Pathology and Bac­ teriology. K en n ey , J o h n S., D .V.M ., Surgical Interne in the D epartm ent of Surgery. K en ney, R obert, D.V.M ., Research Associate in the D epartm ent of Pathology and Bacteriology. K irk, R obert W ., B.S., D.V.M ., Professor of Small A nim al M edicine. K o r m a n , R u th Z., B.S.A ., M.S., Ph.D ., R esearch A ssociate in the D epartm ent of Physical Biology. K rook, L en nart P., B.V.M ., D.V.M ., Ph.D., Associate Professor of Veterinary Pathology. L ayton, E. W ., Farrier in the Departm ent of Veterinary Surgery. L en g em a n n , F red W ., B.S., M .N.S., Ph.D ., Associate Professor of R adiation Biology. L eonard, E llis P., B.S., D.V.M ., Professor of Small A nim al Surgery, H ead of the Departm ent of Small Anim al M edicine and Surgery, and Director of the Small Anim al Clinic. L evine, P. P h ilip , B.S., D.V.M ., M.S., Ph.D., Professor of Poultry Diseases and H ead of the Departm ent of Avian Diseases. L evitan, H erbert, B.E.E., Research Assistant in the D epartm ent of Physical Biology. L inquist, W esley, D.V.M ., Field Veterinarian, M astitis Program (Kingston). L orenzen, Joan A., D.V.M ., M edical Interne in the D epartm ent of Small A nim al M edicine and Surgery. L o w e, J oh n E., D.V.M ., R esident Surgeon. M arcus, C aro l S., B.S., M .S., Research Assistant in the D epartm ent of Physical B io lo gy . M cE ntee, K en n eth , D.V.M ., Professor of Veterinary Pathology. M ellick, P aul W ., D.V.M ., Research Assistant in the D epartm ent o f Pathology and Bacteriology. M en zies, R obert A., B.S., M.S., Assistant in the D epartm ent of Pathology and B a cterio lo g y. M ercer, P a u l F., D.V.M ., A ssistant in R adiation Biology. M ik a m i, Sh in -ic h i, D.V .M ., B.Agr., M.S., Ph.D ., Research A ssociate in the D epart­ ment of Anatomy. M orrow , D avid A., B.S., D.V.M ., Assistant in the D epartm ent of Pathology and Bacteriology. 6 VETERINARY COLLEGE, CORNELL N an geroni, L ouis L ., B.S., D.V.M ., M.S., Associate Professor of Veterinary Physi­ ology. N arotsky, Sa u l, D.V.M ., Director of Laboratory, Poultry Disease Program (East A u ro ra ). N ew son, M arion, R .N ., M edical Illustrator in the D epartm ent of Anatom y. N orcross, N e il L., A.B., M.S., Ph.D ., Assistant Professor of Im m unochem istry. O la fson, P eter, D.V.M ., M.S., Professor of Veterinary Pathology and H ead of the Departm ent of Pathology and Bacteriology. (On sabbatic leave, Sept., 1962, to Aug., 1963.) P atnaik, B asu D., G.B.V.C., D.V.P., Assistant in the D epartm ent of Pathology and Bacteriology. P ec k h a m , M a lco lm C., B.S., D.V.M ., Professor of A vian Diseases. P ierard, Jean, A.M ., D.V.M ., Assistant in Veterinary Anatom y. P ost, Joh n E., B.S., D.V.M ., Research O ncologist in the D epartm ent of Pathology and Bacteriology. P rice, J essie V., B.S., M.S., Ph.D., Research Specialist in A vian Diseases (Eastport). R ein a p, M ia , B.S., B.S. (Lib. Sci.), Librarian of th e Flower Library. R ickard, C harles G., D.V.M ., M.S., Ph.D., Professor of Veterinary Pathology. R oberts, Ste ph en J., D.V.M ., M.S., Professor of Veterinary M edicine and O b­ stetrics. R o e, W alter E„ B.S., D.V.M ., Assistant in the D epartm ent of Physiology. Ross, G eorge E., Jr ., B.S., D .V.M ., Assistant Professor in the D epartm ent of Small Anim al M edicine and Surgery. Sellers, A lvin F., V .M .D., M.S., Ph.D ., Professor of Veterinary Physiology and Head of the Departm ent of Veterinary Physiology. Sh e ff y , Ben E., B.S., M.S., Ph.D., Professor of N utrition, Veterinary Virus R e­ search Institute. Sq u ire, R obert A., B.S., D.V.M ., Instructor in the D epartm ent of Pathology and Bacteriology. Stevens, C harles E., B.S., M .S., D.V.M ., Ph.D., Associate Professor of Veterinary Physiology (on leave 1962-1963) . Stin so n , A l W ., B.S., D.V.M ., M.S., Assistant Professor of Veterinary Anatom y. T a pper , D a n iel N ., B.S., V.M .D., Ph.D ., Assistant Professor in the D epartm ent of Physical Biology. T ay lor, A lan N ., B.S., M.S., Research Associate in the D epartm ent of Physical Biology. T e m p l e , H arry C., D.V.M ., Field V eterinarian, M astitis Program (K in gston ). T h o m pso n , J o h n C., J r ., B.S., M .S., Ph.D ., R esearch A ssociate in the D epartm ent of Physical Biology. T iern ey , F rederick B., B.S., D.V.M ., Assistant in the D epartm ent of Physiology. T odd, G lenn C., D.V.M ., Assistant in the D epartm ent of Pathology a n d Bacteri­ ology. V an K ru ining en, H erbert J., D.V.M ., Assistant in the D epartm ent of Pathology and Bacteriology. V olgenau, R obert H ., D .V .M ., Field Veterinarian, M astitis Program (East Aurora) . W agner, W illia m , D.V.M ., Research Veterinarian, Bovine Sterility (Ithaca). W asserm an, R obert H ., B.S., M.S., Ph.D., Associate Professor of R adiation Biology. FACULTY AND STAFF 7 W en tw o r th , R ichard A., B.S., M.S., Ph.D., Research Associate in the D epart­ m ent of Physical Biology. W h itlo ck , J oh n H .. D.V.M ., M.S.. Professor of Veterinary Parasitology. W itter , R ichard L., B.S., D.V.M ., Assistant in A vian Diseases. W o o tto n , J o h n F., B.S., M.S., Ph.D ., Assistant Professor of Physiological Chem ­ istry. VMEETMEBREIRNSAROYF SOTTUHDEERNTFSACULTIES WHO TEACH Frederick B. H u tt, Ph.D., D.Sc., Professor of A nim al Genetics. O rvis F. Jo h n d r ew , Jr., Assistant Professor of Poultry H usbandry. J ohn M. K ingsbury, Ph.D., Associate Professor of Botany. J. T hom as R eid, Ph.D., Professor of Anim al Husbandry. J. M urray E lliot, Ph.D., Assistant Professor of Anim al Husbandry. J am es C. W h it e , Ph.D., Professor of Dairy Industry. SPECIAL LECTURERS, 1961-1962 A ndersson, B engt, Royal Veterinary College, Stockholm, Sweden. B aker, L yle A., Practitioner, Turlock, California, Director of Research anti Consultant to H am ilton Pharmaceutical Company. B arnes, R ichard, Dean, T he Graduate School of N utrition, Cornell University. B u rch, G eorge E., D eputy Director, D ivision of A nim al Industry, D epartm ent of Agriculture and Markets, Albany. C a r pen ter , K en d a ll S., Associate Professor of Business M anagem ent, C ornell University. D orem us, H enry M ., Director, Departm ent of Anim al Care, College of M edicine, University of Vermont, Burlington. D unlop, R. H., Clinical Pathologist, Botley, Hampshire, England. G an der, J o h n , O hio State LTniversity, C olum bus. G ershoff, Stanley N ., Assistant Professor of N utrition, Departm ent of N utri­ tion, Harvard University School of Public H ealth, Boston, Mass. H aller, C hristian J., Practitioner, Avon. H ealey, G eorge H., Professor of English, Cornell University. H olzw orth, J ea n, Clinical Staff M ember, A ngell M em orial A nim al H ospital, Boston, Mass. J ennings, W illia m E., Director, M eat Inspection Service, N.Y.S. D epartm ent of Agriculture and Markets, Albany. J oh nson, L en t C., Chief, O rthopedic Pathology, Arm ed Forces Institute of Pathology, W ashington, D. C. M alherbe, W illia m D., V isiting Professor of Clinical Laboratory M edicine, School of Veterinary M edicine, University of Pennsylvania, Philadelphia. M arshak, R obert R ., Professor of M edicine and Chairman, Departm ent of A p­ plied Veterinary M edical Sciences, School of Veterinary M edicine, U ni­ versity of Pennsylvania. M orris, M ark L „ Allenspark, Colorado. M urray, J ohn D., General Practitioner, Corning. 8 VETERINARY COLLEGE, CORNELL R eed, W illia m O., Horse Practitioner, E lm ont, L. I. Sa lpeter, M iria m M ., Engineering Physics, Cornell University. Sears, R ichard M., Cattle Practitioner, Cazenovia. St a m p , N f.a l R ., A ssociate U niversity C ou nsel, C orn ell U niversity. Steele, J ohn R., Horse Practitioner, Cortland. Sto n e, W in field S., Associate Veterinary Bacteriologist, Laboratories for V eter­ inary Science and M eat H ygiene, Departm ent of H ealth, Albany. Sto w e, C. M ., University of M innesota. T odd, N eil B.,Teaching Fellow, Biological Laboratories, Harvard University, Cambridge, Mass. T hornton, Gus W ., Assistant to Chief of Staff, A ngell M em orial A nim al H os­ pital, Boston, Mass. V allenty ne, J ohn R., Professor of Zoology, Cornell University. W arren, E rnest N., Professor of Law, Cornell University. W ootton, J oh n , University College, London, England. W rig h t, F rederick O., Small A nim al Practitioner, H untington, L. I. VISITING STAFF, 1961-1962 B autista, D im as, Lim a, Peru. C ro fto n , H arry D., Bristol, England. D obson, A lan, Aberdeen, Scotland. F ries, G . F „ W islock, W ashington. G iese, W ., H an n o v er, G erm any. I m o r i, T a tu o , Osaki, Japan. Jo sh i, S. W ., India. K ow alczyk, Stanislaw , Warsaw, Poland. N am ioka, Shigeo, Tokyo, Japan. Savage, J ohn R. K., Harwell, England. IJsui, K azui, Tokyo, Japan. Some of the netwhebFuillodwinegr sLoibfrtahrey; VaentedrinthaeryWCaolltleergeL:. SWchiullrimamans CHlainlli,c.administration; _________ COLLEGE BUILDINGS AND RESEARCH FACILITIES TbUsCiyaHtnuyiaEavuntegeradasNicLtEitynaWokatfeht.teIYhTtehfOhaaemRSctaKoca,iutteasySLcFiTsiietAnyigngTioseEtlfrhataeLupVarspkeoEreuoTistnxhERi-mR1ce8eIgaN9nti4eotAr,lnayRilso3Ypf0oa,Nn0rCt0et0wOohfepLYteLhcoraEemrmkGsaptEnaautet,sent,hteoasefrtbeahoCsbieulodaitresdnhn2eet6osld0lf, meBduigIlfenefsalo1of9fr,5ot7ahmnetdhNCeoeoVtwrhenetereYlrlcoinirctkaiae.rmsyIpbtCuyosh.lawlesOagyfeaiaomrfpocMlvooenotdnhoeaifcnwttaiokobnnoAseuiwtrwlitibnwtuehesinl.Bdtyionsgatocsrnea,st,NthteheweeabYsutoierlrkdn,­ iepatnhxongeesdssrcemcosislscoieecnsdutilcopmbatyslyonfsdoaecenriaeryrannlnycoeitfmystw.patehel,slev.ieswTahaocmerrlyedps’l,cseolvenfaeosvttreiitnrutiegntaeactrhohyeninecrgoeomlflaenatghdienesd.rfeeiTsnreehfasoertcrphephqayiudnsidipcotmahcleekpnsblta,aansnoitdcsf THE VETERINARY COLLEGE LIBRARY T he College is fortunate in being a part of a great University where piiccPw(ttHnthhVuua.aaeeTrrriesFlsmtrrtlhClleeUe.yfoaaennrooTwbnnittlunoliylhveevenanppriegerdes,detyterareeoriws)ilsipdrioiiocitshbp.odLnydiorrpbti,aiiFaohclcbtrwiraoapewyarnylirarlaeshnssirslcspaiyita.cobtheiGt.inhnnhcrioOsoasdieInaivctrtnslhsyrsoaeeteiosevsrnsafscnweatrosiifaomotdsaeofieitrmestvnnarayolaiondivinnnfcnmittearthtetoirtaaraotehfynigwi3araenseem5snallaetli,sSda5cybedittsth0tdraneiua0aioept.aacsrennnacmyevadcrsol,oete.2otfllwshds,uywOs4Nc,emh0iefetoei0dieofcnwnn,tash0chcbet0eaieYhhyis0lsnni.ieogstddhiarvrevokoeohsagawaulopwruitsominfepemohtfsordueetoerfgnns,srxiurtoneistltmameahihfSbnfuteeaucrdntaRslhCedncFruo2lisheolyer0sosolmwsl,sawl5e6anea0g6oetrldno00esrfl OFF-CAMPUS RESEARCH FACILITIES mfSonarIylnsdreeasardenadHdriictlihslo,mnoaanbltlooiuntahtfneeitcmhstiruaoelpuesesrm,hbapilvfaeaerscaisfblriietotiiemcen,s atochnnoedntcshmtaermuectcpaatuebmsdo,p,luiocsfno,dreaisxtettharreasaecmstmuooorffastl1fa3fpar3amcrialtciatrienoesnis.­ 9 10 VETERINARY COLLEGE, CORNELL srthamteBoarlerelysifpdobaersustirultedrhseieensa,gmrcesahxnh.eryacvibeseubilloedetisnn,gobsrufpiolatrddhfooorcuksasingogrfoatuhnpiemiroafolsw,stnam,ffoasptneuoomfplbweehrsitcoahftiolhanabevode­ POULTRY DISEASE RESEARCH wrcgetpDtdtaoeahqeriiucisiraiTAnPutnnyecechdsioaeehknnkpusodudeteftpaelohnnlyetRteafrseer.xoiSdtSyeshcarndssoEneontefyidlyltuaoladaalhdiddsedgrtsreeteiinceetnpornruhartnoponlgesrtysHrkresHsotteeCebi,iidxacyareluolLelrrpusqloicesa.oecluahpednrtnAfibaaeiiidpagovmrnroicpcanranguiItheeteilesitlisndvtoaalthphaititefbcaseahine.hldrsslcredadiueh.nbb,tFboceoicgiacaewnkrorckcemdyenlitsinsatelsdihdibblriiatoesiispioonsattsneeuhertldasha,aetfasotsreeofvoefocitmnroi-rmonryfrartauboreocerssptatteyhh,ehetnoowoeaoerfdapsrfaluo.oncetccs-lichadraaisaTokatntmmnnohtglpditorpapeohayofbuurenrofiesoscanf.thlsrrvohaaeasiiiAetnnbceerstiseovkecotLareeincrt2gyrhrnaeooda8catsewinnlohtsiojgsesiruacserya4lcasnaIps1mmrsmecbae-lswtusroaaaapia.nnnoirieuotnnalidndesflt­­­ TRHESEEAVRECTHERIINNSATRIYTUVTIERUS lVdofnttaiefBfrRuwinhrorreibrnsanoeieesegiverahTITlrAotteeeillseuaunerheiqluaeDfhh,iefenssrdisunaagtcvteedeeSiieeviarnegsshaRale,.gsercidempitdrVaphmteimnaldAurcisiliotstssneienoimsotoeaIeeemfnraow,egnmrnlsuaawoistvsssakasnsrsthgbbutinhoectiresrhefiaeaadieynihdifovnrItremcnnreeouinleentcD,rhoodtdreIhfnntasoeanbgeo1eiatloulutscfnssjiyoa9gcibbermpttn.atboo.5ctsuooiyjctruhtp0unenethDTbmetrtsuw,epsaceiilyeaeevotyluetorttradthdreeieNttdwhpfssvi,eed.diolsioepnoieeoostria.naavFhslmewfgffrRoBeytnpeiaoeodhnntapdigosgtofrYhconaghsemrmcriataeeft.evoeoamthSkrthadoeadvrdtiieIfnineketlsnrutanuefnseybigtyeonrdosahSdbyeaImlkfitctnonoltenndytieieaaoettTdrlsrdineshurtaoscndttsea,rdshmeinthfHteulatteIaVeldbwnuursnsiaytimanihsdtltiemshGcselesetieesttt,iseoaiecehiatunotncrtlhsotiriCaenaiautusiniietsodbrtvntenoatnopeeenetiyaaacbftsrwrfhsdacirrnrfelealeConeoyieoDttveaacnhoafffdrtobleuroeCfthslellcrrnldoletegabieeotntphahRdrtrihbeleieoeiRlkenrelosfUssleisoseonlsesaiprgItussanneraisoVginrseUneprceaitgewr:sbhvaorevopafranatercrolteertronilddoieceohayicthrrvrlduefudhrsrdmhveneicsuiiagtsLenewntrewaVpctCeoydsaeia.gnntaoinfoeroeebetcoryifrtyndbrcvddboeknekefetuiiierrec.eessssVtaauirtwttreeissrnAvisthcpataaiatooaoiaroaeffnsslornuurrsiroaiyeebnisnnyyglkossrr--r.­­­­ BUILDINGS AND RESEARCH FACILITIES II UdfrlmstaaeetirbsinmsrAcuereoieecaitanr.nedstraoeedcatdt-ahothfe.crrSedyceaTtrei,andhetdeeiafeasfsnnsneottedcielaPmatalicutlvcaaiyobheonlnslliniiyinmtnca.giinabo,nHlcutihliensiulesiaddxroliaitlnwnhdamggtdai,oyiSotdspneia,eoircgvrtnuqshni,cnureteiiaoctrensheadiadbnctudhklfieibaulbnytdplrlsirya,ncirmvagyegnasa,qutteuiwcobnihfeepefdiirapncoeceegnlsepddo,aierfgnasslusa,ien,gbdtdnihorsseoarsadaubuntsfebdoareiornstcismddeu,oeslccttauhtoofnhorenndeerr­­ SHEEP DISEASE RESEARCH rcituoneonsgAAndemdaeainratrtcrfeiiahlohnwocentctaolsksmi.nhonoiefnifeant7psht5ehnobrealanaeotcpruagrn.lreiacsOpialnalnoclirfynaltusfhlseidaittssnieetnsrdatigtrloieaooffcannctscohiaTonleifdute1iipre0itkn,si-oaethfecnyaorrsesnrHhaprbaliaaelsilseps,trniauenprcrgeaaeeqsrneituittisxelicyppsiureplbruraeieignrdmeladynetfeeonrcsdrtouacnmialotsranatatbirtnifurlniieoccmtlatalefaleioldnldysr.­ TDRISAECATSEISN OCFATTTHLEE REPRODUCTIVE hoef iFfrieefrptsyr,oaadcruerecsmtivoaefinldtaainsidena,esdeeqsiunoifpthpdeeadinreywigicthahbttaolerb.haorond foofr Thouurksienyg Hcailrleffuolrlythseelsetcutdeyd RADIATION BIOLOGY bsistorAduayncftieciednoldtuoengnltareabarlo4fr0poa-artaorcftrruyenotfidrnaatccmhlteueodnDfitnlaeaglpnasadtrutrpmdaridoeeinvsatitdiinooefdnraPbedyhxiyaptshtoiiecosuanUlrenbBiifvoiaoelcolroisglgiiyttyyy.h. aaTsnhdbiseaefnawchcilooitlnye­ ADMISSION AND ENTRANCE REQUIREMENTS sSctwioIoNmonCpytEleoeatrttihshoeenofNfoacfelowltlwloeYofgeo1yr9esk4tau9rSdst’tyahsteemtuVmduyseitntieiinnrmicnaulanumrdyaepe:Cdpourolclveaegtideonhcoarlveleeqgubeieroeenrmuethnneitvsesfarostiirstyfaa.dcTmtohirsey­ EPCBhnhiloygealsmlboiicgosishysr—at—rtoyo6r6—ryZsse.1eom2moleeosssgetteymer—rehhs6otoeuusrrerssmh, oeisnutrceslr,uhdioinnucgrlsu,ldaibinnocgrlautodorirgnyagnliacbocrhaetmoriystry with oorhclcciaoatedhehohfnnirascceeaouTAATeedtstoonlhlmrothhonnEmusterpaaioegeierynchsnnmasamyn,gatyeidcpcdp,renlelsoiyehpipcniniscauowtcanllboidhoocirwiismicmcsrce,na.obheieailaddoutltotapasnonth:ehmmonlteatgmotiaffqgnrniysnlaciuufirosae.aystcoeEcaaibtc,.uqvrhogiynnaongruemIeedetgragotiiraaeldtrapetviiratmehimscnndoosetmhoeeasiirria,ucvsnsitynsetouvcprseompinshmgeieoyhwteot.cetgeensysyenhtcoaneT,sor,hebrsritiishsko,ticmengsets.aeralaemd,ideankerncAwifenyaadxaenettvndthloprhotcacdccaresaoetuolkoomptcnemburmuettpadinruehirrelanhiospsdoyseccttyeleotosihtucoscsists,hlgsicmositiiuoi,nenuyt,hidmlisomcadehooeborlmzeag.nnsimieurosnvoyt.tidrtoietoms.ztrocTe,lthoydonIraehfboayetggltaaslenu,rryolchinyrtystbgiooec,3liiy,fodtifu0osrhtoopueelyolserdrhocsrsprheesieoigirifroel,cnmesgmyooaouufnbaslevomelilbtoldnsoehrrelcspterarweetozehcnnaotrauoiodyodgnnrutorvh,geutgsslhielodtaeoeaapeoraun.ggalasvliorryaieysynceesaf,t,t­ oioT1nfn2sW8ota.inOtAseuetthmYiolaEeenlsafAtsefaRtorsS6rbm0aiOtasssinFesbymrSaeescTqesctmUuaeirleDraseuutYenr1rei2htac0satresuemdnbduiieettssegtu,nrenbbeeiiutsns.tptersaMreospsmoaerserentettreeiernddeqs,qutaiutsithriueremteried1oef2anob4nsr,yienaw,tgnhhadeintchsdpheoamiarnptreaiecsseousrvimulneannger instances 62 or more. ArcioclRulelEguGemsISwaTpiEtphrRionEveDNdeCwbOy,LYtLohErekGNESetawisteoYnwoehrkwichhSictaahtreeisEareduguthicsoatertiirzoeenddwDtioethp,agrartanmndet nitbts.accAcualr-l­ 12 ADMISSION REQUIREM ENTS 13 oowsltahpffhuiosaertnhletCldheaeosetenulrllaccedrheaggeneeitgy.onrrespttcehiosateulrlatteSiirgcoeteuanstrlseeaagroEniussddttcseuhircudoeanedotilivNoaeninerswsdDirteiaYeegppsoipasrrtrkaoetrmrveSeetedadrn,et.etg,.oTisnAIhtneeilrsbgesadeihnsn.oyeni,IdrofaNdtl,i.Yntapr.dur,ddaeaorc,enutihsdbcsoatwnlcloaeyosvtreartterlool,­ dmbAbbCpbmniIittTstahtyeeerou,hoHkeeeaFwrrmlaatencctrelipEhahcnenlteteqirraeiatgebtnqgxecmuhi.,heemiuespFCieOmaDerseiNAsooeeofrnpurtroufedfde.bimaRtrmiYbgemdcesa,ttAstenMeiamfd.cmsnooecittgaonoigionErfeeattcnrfefstrofPxieeewddtmciSoxceev1nRbuhfqetpp0rcaacupylAipuoeaokrctcadrauepttranCaeihidsleitnarolotlehimfTeinstAiaurfnooaesentycIripcntrddatesCtaPessoamO,snnlf,sErrintedodfwotaheiaaaafousiricnniefdsnsdicdtwttaR,ttidimcieeaaherowcihlErtadnn1nieueoaondaspm0tcs,Qsdatsssfredol.eiddNiiufomUousnlimeSwdaefAscenlgfudIatliteiwa.hirlotuelRsssdhrlyonnnttdsAomw,Ee.Ycio.enwoboihahMtnoeVtennnBhoapotsrtlceEovekyrhetflatataesPdeoNoerhcSsnllarureritaTatopribvirotatnelccehirtfhaefftnteeaoxesesaimfvrgiaptuc2onosyoCside0enfoCrocctrmmodro5ouCkohitfewlefrhsl,aeleioeltnelfteriertolysttolgfmchllgeeflyeareeisaeedbargret.xnbsmerlseopnwctiepewvfrTrod3ewaaioetutAahiarwercdshltipivelnfiltthmlegdoiiesooqlaicncorlmdciiiuiieiecunlnsrkvecbaiseaeutti,enruiebtpsslqenmsitsltlmommtfdtueemouawmmiritaunuacrrrehaimrekttteestseldooyeeesrtl.t,t­ vaAcaptipolnicsawnthsilwe hthoeyhaavree bineecnolrleegaere. d on farms where livestock are kept rshehasovpueolndtoseibsapisleiiltnyydmfaoeterltefaaaslrltmrtehqarenueiimremamlosenntthtoss. qaTsuhafoluisflely-twifmohroe faaadrremmnisowstioofrnak.remrTs-hrweeairtfheudlslowmrielel­ yqLeuiatitrrlsee.mcernedtsitcwanillhabredlayllobwe emdeftobryexlepssertihenancesioxbtmaionnetdhsboeffosruechtheexapgeerieonfc1e4. oSfceaaofxdtraTWmpvmateaehcphrsniceilesteeictanfinpigerttectieieavvzeqaneeesoucnrrviessetrphei;qetorebumnusyyateishertvicieaboneoadclstrneneqt,,hiubsgweptieelhrarhfetioopo.snosspsrgpee,lheiwwacacssvatouhibemvobmleemoeuhnnaaicoltpvhyntaipelpnyletpgithxchlteipaoectenhamrftmneisuieitnelsrnalnicrmwraeeespiuqtlupwumlurldgiiii.tmcreeheandpmttifsrotaoeonrnwvmsteoh.sbotwahtIanneaiiilrinmlreahatcUhalhhsveanigeniafhtcuneaellddynsl onITtnahHreayEcianC,AowNPllh.ePYigcL.eh, I.rCaeTdqAhmuNeeiTssOstiisfnofhgnicoetuihsloeddfeawsApirprdietlmedic,,iasatstoifiootetnnhrsefJowuOrmlifylflsic1rfeeooqorfufaitdArhmeedimasysiesitaosrrainonpntsrosce,rctiDhepedat iyVnogfHe taetthhlrliee,­ 14 VETERINARY COLLEGE, CORNELL wapilpllibceanfut’rsncisohlleedgewriethcotrhde aasppwleicllataisonotfhoerrm.credentials. Full information rIasattTeiotecoHqCltenuieusoEcrnit,mrbdleitNseumkhmeretoUrtileisatyoaMtenkelutesettssBoo.hnoEwaTebtntsRhiheslelAethaooeddecaffxmmovcpsnmaieitsuuituelmstrmaddeipobideobtnltntseheesateeresf,oeteowfnvtarhfiuintdlhamcdlaeteopnrbnefcpcfeiseaqaltriincnudceubtieashrlbernsteaiaeytntsrfagiooancwrfpdnagemnhottrhhotosiebetonotecneVnwadaelaneylaoctcarceimthknnerhtipneeentatuerhaefpvtardaopily.tertllhymwiIChecna,eaoilsswnltlcpphtelhh’rigrsaeomoeetnplpciaeocwthasvesaratideseialrcesrl.­­ that is feasible. PswwfctfhieoolRielerimleinlIgcgcamObthdaieioainmRntgpntdgIeiipisnTeodlsoiYfaicfwfotiaselniotttllhiuiflontebdogaanuecpsnnfttt.piehtlcoseelSeiexnctsthpueaositedlatshiicrebgoeyatneinpbtatesalpopievdslwpiimddcllnhiioaesiocontttatitscoetehoneidnaoae;rvpnrcleeeyesrnaqiseropsnuilvnaryroieror.tiretvtltoMhyhciseteoiiJaalmmoueryncsdleepyashae,l,lretl,aeyt1t1enhr.imdidtmes,iiatgntshyhaaiesaenthadgtwlpevhaprafoetialenrnyckstcg,attoogrmdaraeenanqomitddnuueiistrttttfhehheotdeoeeer FoUfOntiRhteEedIpGSrteNavteeSst.eTrUinDarEyNsTtuSdyarein uasnualalpyprroeqvuedirecdollteogetakoer uatnilveearsstitoynein ytehaer RULES COVERING ADMISSION mhfDeacdwwtlofoohoboisefasieislrtArvlp1II2lltsayoneClohff.e.aeobpftuwdrspobsusHttElpEtgohriisreplhrlsvatahanfm;eeiblehwiCecclrieswlulcerahacltulo,syaihcalttitnanlralrIateaetnltnUifigtiimcsnfcnohnduneatbmndutanlieengutnfeelidihlcrdaodsvdardamfaeitUrierttarilt,nbheifsdoreutnofoaasgy.feeNamosiuilndrmvtttsAl.dtsnemyeloYwhudstoaud.rucue.incietwsefeshtrcdPchopidhsdiaUiothdeeecroienyd.rmocnarunsgrgrwmkantNgtailaeipetad,vniwrshiliottmasme$ysdodheessdr4frsadaireius5suas,oewnlrixtbsh.sfttahafndttphyeitiouCtwheo,tfeeuhnnteonaicraoodclndorentadlreedee.cqwtndrrppdeweebmutidhoopaartdgeiihosttonyiorliaaaonilesesnlmsttilyteme;rienuebatenesdygrmisecesntnuisrarenasftoanuuetmirtottovdmireiclsohrsdeaeurfdfatecwssdeeyaahaaltirdeadteattpnocinsisetoroestsaohfteOnephrosnctweedosafetiootfocedcfshauietedenctttsnheliosnnexehadvemtopoilbiaoarhsUtfeytbwanipefrineensnedstpdhaAsstosticehpl.eoevampeidipsrpelcsencomeoaecrratnwrsondasotanidesrisindvieunttiquetlsyb,galndpsiucw,poilittoilnabetanirhhsseotoatltyesiyhoooeessf,tt­­ ADMISSION REQUIREM ENTS 15 bseemgersatenrtehdavuenbleesesn aflullfhileleadlt.*h requirements pertaining to the previous IMMUNIZATION fImstfsicohmotttiuunrerrAwmmeddnaieeteitmuilsnnslonycamuttnetiab’iptsaunhseyprmfannfsalsaiiowiurczceasttsiabcdtoltteelbsrisupeyobebebcntynemeecfcdeauetwseschblsursfaiotestfbliesienlulfmrlUnils,sebcitaidndeavtwtttfieiaeevsroibrcodtfeefychafm.rdoiecsnftrtithoaetthtoyedtriheimy,eohbsmncmoaytUounvuushndtelstnhayietvsietlnzoaiebaftbCpre’tssesbiioieoetsetrhnydunnco,bbeemfpmloraaoletegrnirrifnmatdfitemoepieensrhdadosmbytirtyschcebeiaedseactlrmtf.tihthoaiseafwnaIrtiflean,clifspatfttorhhottueehpdiixdgnsrpu,eieoosrnreftitoerhtrnt.nqareyugetueniIvaloifttiaarhrhtnesscyeea.t,­­ X-RAY cpaprXroXtfieeohnrrnm--ggooreEdrcrsiaivvaeevssmtyyiiiettdsdsrmrrofhaafaeeyioraltotodtdmefiicsrrooCiet,taltnnttluoihyhhctmfdryacaafauneet,etantnlheenpfdadl.eiittteltlanarhlWeicdbdeswbyaotluhhyeefarnirrstaeeesteiaqranaqnsrd,ociuu,ignighpbaawoisienrrlttngsiiieashestvttrtdideyhhuwanae;Xedpteothbseoehd-oriyfrnciritapehlohtwwamyhna(w2ayivtcrrrt)aseaasenhhet-isdhuoqiiceetaoniemiaunoahntkitclnhbmaersoehei,pseregnxea,meriosbycsrthmenewihato;epneXnaoidrnotrdto-.nemghrrrsotaaeinhuenbwyr(anssw3.eatmat)f,syiHtooileahxflarsefeetorcbaiommnhmnemhemeideinoatsaisiytnntyaoetactholXtrdh(lhhwie1dusnr-ae)rredngUvreageopesynsdifeCrsspiexartvoesioiprenencreafcepnirinthnfostiettitieosihrhelatesltndyeeal,,t, MEDICAL EXAMINATION rnAapvsgcinetcaeiahufvqdlcErtytsdieueievsociinperittienarey.cntretae.miyWteamdr’pdsnsr(hieh,uTfpvynwaeonheaasntnrdiilrisnldscmelaaaisraadrtaiubgsnnepmncerCttcphaueuiwloodsnmdurasriuintednslniaalnoeehedtptsdntmlereehleah,,eypswvlaspnasatristiheoientulcwslcmbddaprtieoelabeepeticlencehtfnoclitdesyarsonuatdleniueimwcs.tnzseodaetauAadetrdylittnefltoehlofqtrfrneosrraeuii,moranciGwlmphrefsreotheaehbcdrcnyt-ot.emok)ehsnfxiteoeAamcoobarttieUfetmniauohnsnaMifniuatnntiivlnvaaeylgmbeeedttdiiedreqvioesctcareuhenioaogtnteelmyurmsoauitCteCfsrdeinsooldbluicdrfinnyiapnooceaimtilanacrbelchgrflo.oliitrewssdrwAaeetoe-udxmihnufldUtuaolptheemiamtnadahbntlineiiieeest.­­­ Sch*oPorlostoprechtievaelthgrardequuaitreemsteundtesntosn sehnoturaldncceo. nsult the Announcem ent of the Graduate 16 VETERINARY COLLEGE, CORNELL aa yfoeramr, htoe bmeusotb, tauipnoend rfer-oemntrtahneceU, nsiuvbemrsiitty.an interim health history on TETANUS TOXOID ryprmsrudapttaaoorIiitshnheoeeefpnvtefranuncgegpxoraoaaUAcyoCrearpoottcaoiconrotiihbwsecrednumndrteybirntIeetilrtedcohdtgdogetlroveistvemhqte.vrsaiaehiaritidfeeodeatutaoroiotrteioItiamhnecigcpioruonfnutoltcorrieaeaorawoasnsedemtenntattttiewrbhdeihdohmoefdbtipoomtdieutmr-rbnieoeuarhhnfye.ttownbysrsufhihaayeemebetn,lngoIiivonetoseaynfatlteiosiieufoiselrudvhhtjcmzmestsrhtunfsoretaiihbmataasetiamesrconiemsaegnettnetczytenoreiurhxnhrgeiousmaou..uasbedmei,nelgmtstndrnmtpeeseieIueIsnhoomdierehmnrcfoeanstuziibsai,rnneyeostnzsrtsiauiemsmso,puisekzosexytttn,swooinaetddiuobuoacooiaoastnotsleiaizerininiiptsnifrdmo,nydsanoemaemeebia.b.cnpniattrntireferntiye’filt’ernosTeodtTsytuadrgep,cbntraniaeeiidofhvthibhemrcynnehanactqseoiiieieaooaoerrnoqvertsuvnttlemticxorisueguwhiiwtUtaliuhowriaudoseiasermstneerionpuufghexteslieedrreslmiilstppqfoheinpdorevlmhtrrnoelruebuh,omqieeioefcabtmteitbmewdymruyorori(cweadsoiaieseyhmipmxutniittnrloidineitothieconfjeboldhbtyaesau.rutolehidiiysntde’ssirandzusrleetnbsAe.helfnyuasiCrotwefuh.aze.htfoidaowfsnoidsmoratdOigfiegoeeoretlsoirftm,eionrhlrnrnimenapsvuUedmo,treeee,desuaepsnemsnusprnleoltnnnobt,lasnwpmair)rptaetoywrvnb,hihcawtrmobttznhoeeiaonyeeuislbeaairerdntnoeosdcetnbodhsehitdcaresaioioblchiciatteditldtntggiopyeohcsyeahtto,atvmioris.apooadivnnatfttsorllrsoeieeSoigenaedgCfvtnnrniriaiselattotresetnivouaeot.surcuissadyegttnbdsrettytlnfcaoneoeeideesoetifeovonisaraterotnnatiiemhernaubiolyseaaoettrssnldtoeeeesssssr-,f.l,,­­ ADMISSION TO ADVANCED STANDING osesqttoocexruhrccAaytoooehlnpofipoeffdpltxises-clera,iaawcmtottsahihafoitniotnhrntitshadesssefti-ias,boffeceoooCnntgrrorstoirrflanayialondenndugmcicmarneeetli.girhlsstrsN-oiseoiyfifoiqoofecntuanahtpirthereteeoetcsrowlmsacotooshoenasfrelndklmwttevhsffgaiuioeerlnaslsrcnttcybw-edoypeedhaemrceiaarcoprssdhiuetlmnacerntlsnthtaiieStdsoesttesiehnynpodeatgdfoenentmfosdseatibctsurahmeeednisrmysuysa. asdewaatrvmyrdoapevbneraaekesdcnrsqeusciducnseiaaodvcttofriiasoectlflhdentaahineasctesrt,l­ ADMISSION TO THE GRADUATE SCHOOL ScGhoroalduoaf tCesoronfeltlhUisnCivoelrlseigtye aonrdopthuerrsuceolwleogreks imn atyheenVteetrertihnearyGrCaodluleagtee T H E GRADUATE SCHOOL 17 ashnodualdlliceodndsuepltatrhtme eAnntsnoouf nthceemUennitveorfsitthye. AGrpardouspaetectiSvcehogorladaunadteapstpuldyentot tmfmsiv3atPwthnrohua3haoeeardcerTAn-inenrth4elcekDhscsotw5pessrtfoeswuedeiteodgoauooadnrroonpVldffnkydwrnihoekzeeftteooynhnrohet.anerefeidrtentkisqrIndtdwirtyhuUcnAeieanheeoitgasnienrnhavolnrerneilGdneryeeveavdc’heosgsreeroyoctruCearsifureehlsgwtdnoeodrasii,oacusgtarelrshyrtlisegaaaaiede,ttmoertntgshnheoiecnscodoeeneeefhhsf,nvScnfg.opddie.eectawtrore.rorhCaloslIgcoicohdtfolrrshntoaialeueuoenilsedseas.rdrbssvsatitiieaooeeathttoSmeusfrnenfpfaacDpaooiaeotenUnllruicnofdedoinndscatncstdhtsifluatootatwaueuddgrmcCtdadadvyiiovmsylboeawifeStfinnmosoinooVteectnfaasrmrsseitemgktptedeiteiefsoeqtexotttcarndusohecioribtaeoiwneuruvlawsltaldalhanneyCrceierleydtendenahilraantnntiMtpnssditttaoorfhtetaioeedptqeegtpddhsaoaspurteienaeDoaccmorldcdlitruoinnhatattdpuceryaiyvtretoano.ptoyaf*prnianrrrttagoitiaooeheroemoodwndtsesfff­­ ITNHEVEDTEEGRRINEEAROYFMDEODCICTOINRE O(DF.SScC. IEinNCVE.M.) MGreAadddicumianitsees,ioSinschtaooofclu.annTcdthiidoeancfyoolflfootwrhietnhgeDdirveeiqgsruieoienre, mDofeoncVttsoertemoriufnsSatcryibeenMcmeedeinticVibneeeftoeorreifnatahrdye­ omiamTacfmodnafbprfahiudcei23Ci1sAptvtotlusde...sethiraestefilpti’ooeTtntsetHHyteceyeevnd.ohpbnrCeeretwiimoriyeTdddtnonaoohmmeaphamrgcaonteccrvleuucraecemytaoaaesasnqshtdlnmttfentmidlumaeatedwdiitvharnchgeidereiiahceaudodaiernedancnvoilvaat.atittuagedetcecoyorlTerheyyirranMsdawmahi:ootshotevemeeffuiuaaufmltelslnelshyfsseesteorhtitodaanbevebrterstnnihoerhdeehcetsaaresirefDtorsvgntetesornewifFaeaeiaretuslvarytetropraSiceibeditassodhnodcrneusfamienim.daotecdaessscbinanhntdfiieviteyyditbcorivitgawevetldereicepnnreycdouiaruddcloy,anetldaeebemeoldasGuhgsavltiuliphraertitcessnwedhlteuhhr.eeebieewnminteatdnleseildiiofycatlrsastflhermnoeor.tcpalnhosuefiaavqtedmetclonpseultlteyeiatmcteoctrahtlehtswohqifneirfefauniayaohhrraiittigivDmufphmssoDeoarpeitureelvaS.hroeVmmoibDtpefnsihv.irneibMtileotecvirhemtinhdfie.dyraesriseeliosdisooogmcdtmceCoffnfarehgibeneonortheefdladhmecodoi.roneeJisels.r­­ PVaef*JrtaeIIBgnrtyirniassaapprchcyetoscioniMa1nsl1ied8odcefairacsenitednhdseeto1haft1aahr9teceuoraalfttnlyalt,ehnianJegsatutenCagutgorwaedasorelypmuo2anfa8riyL,ttse1obg9ofei5fs5ltawah. ctioiscorenkpprtlooeefdfaedtsahisnceiocgnoGartodrlainddthgeugeartteoedee.fgtahrceeueltpyor.fovDisoicotnosr of of 18 VETERINARY COLLEGE, CORNELL whmSifmgmCctttutstnoahahhuaiprpookscoeveeaataACp2e1olerudadeinntn..lccekotgnleliCioteiolrtccuogmgRaAaevygumhoiirrrelledcninerrdasleiaarnsaaesaeoeCenlgycvolifeyenlsop.sfnfeeouaro:rodfhglipwnralbmmolpritsoSalrctdhechottofrhhoeefemhUaoeareomlriepdtoaktteueslxairnheielft,rctrbttrkatsietrhscostweeveeaemlebeioefwtynareemmnidsMoaesusecridroilrrnlwesihusbskiaecdsrldionaghseake.ocdnsthceifttyausrruniciiaeCTclecwoliirecltmntnanadishaManhtohnhdrelchtiakseeueetosaCileenedeCctdrugartdrsdaowieDdaconoaheaniatvtttacleyrnesahhrsipoteleyandvegevtsieatriulcaglidcoofehni2hresdhonerfuriitt.iCaaodiy.syirgotpnpsmvohftoaanattdhtefi2erctlhtenrhleeeeh.atitteoaiw’rMshibetsgsfaaNcenspeeoendngCicdeswaecsopyeidorduparrnetatmgeoretibetnhaoytgcrerpdmcaecljiekfs.aoguelilrieydaetalafdooclststIaclmmhtsrrC.isnbtiersyeewhhnieeoumfFonacaemolhcsntoftl1lucahhtalfeileo.lbitrcrtcialrtgnoteprseofhhheIcneeiiragcrrfiwsceecirlsseatultspcilhuoryssidrluotnaaleeenaooaeeuifvrigxnwnnerffsdcnrmesaitiodhiotrhcccmttnhtmiefarhahoauuhsiosdgeknnliemlirephrl,nurrrwVlaadiietvapmenGnctfolccolteehtllouaicorere.ottreoleketelceadttsalfyiuidn.oporurtodotiimmiwtutbennunotnTamharmnanaoaibsehnnabdrrlteoroltiidyeeyyygoeeesr.tff The Veterinary College library COMBINED COURSES 19 TSSsfthohppheraeeelcctlyDhiiaameisllvhaidCasCkeiloeoglomnrmhremaeeomvc.fioeitTtVtmtetehheemeeteetehrrarneiielndgociaarohnrtmetyoioptmonMsihnseeeainxotdldolaniacmsttbihinieooneefnerotGeshtfshhrepaateholdclecnauasnbaGniedtbedriladaiedSddaadctufethroae’eorstsoeasclrne.oSeddmccohttpomooeotmetleh,xneepwcnryfdhe,asiicncsbuhgutlotttyhhttiehhomneef SEMINARS srisofftteheaupfsrpceceTeipohctnlhhmiaricataeteryeslesitsriesiaocintenriufwfvvneoleeogtarphersrsrauxtketilbp.ofhgirlefdeaeeiBctliecsvdirytpuoee,salndatmtpdre,dstieorevsmaiafocanankufenntadishnsrcnisoyntehgesosvdesefoeaaomrsrnwaftsthdneihhtgtetdhuohhafemoeitstgaidseorCarrmseneanhopsdiopilnomulmfreaaraegnsetartpseededdaltivofhcrhtsafiaehottnnlutoelcghddsseetpetotduahsnrcskdoeetitaeesmgusen.terndiidesaetneTssnaos.icihrntrnrsseodecpfodeiordspniokreteeasnmntsenbohptcdilwaeeneuelclaltpneiyiprarndtoalgghgwgreceatraoeoainnriisrnnknysss­ COMBINED COURSES at SCtuodrneenltls, wmhaoy,dboythjuediricpioreuvseetearrilnyaprylawnnoirnkgi,nbteheabCleoltloegqeuoafliAfygrfiocrulbtoutrhe Bcdmthou.eSeurn.rivstnseaegstnefdwotrhireneDrate.hrlVyaetat.MtckBeuer.arnrcpdihcceaoeugrnlltrouseremeo’cssfucdttiiahnevngeerllebyepese.es.Traihptoipimdsliecweadhtnhetaorbenewbaydwrodocneuecrlotbdamyinbpdeloecutoribneulqgresuetrihreecegrdiersedtirqifatustiitorhienne­ bfsthiialneeIccdnceb.atedlIhagteeuicssnriehesniaoiiontnunesgltdoadtnnehbcgeaaertdsecmecltehaiasbrnresedliefyoiodnyruaeetntaeodrstshethrweasertieaolvlpooepbdrtedleiritcinhpnaaaeatrtirriomylnnyoictsotfpeauoesdrrsnsuetvtroeacatsanecncaroeinmncoacaptranlybnedetiemdbgeaeittvhdegeiiisncfvoienpurnelntahtiniinesl, pthleeteadd.mission requirements of the Veterinary College have been com­ REGISTRATION soteabhilfrytleiyEonrswveaaspgerateeyrimdcytshiteaCrestalotodtubiplarldoeeeyegenrggnim)ewin.ts.intisAietiAsshnriffogrtateetnehfroqrtefuefcrrbieooDraememtcihidnrhpeegtltctheocettealoriormdnresDgmego(iiirfsotsteehttfeceSeatrdttttohuhwrerde.teoietgrAnheittscghttaurhAedaleeadtiUmrmoRnnireicei,ngvgCiiehsissratetsrtrlraiaetmatrynitoiduoonasnfntrotofrhdfoeseagtryutihUtsdheeteneexnircVvdteoeaepirnytst­­ 20 VETERINARY COLLEGE, CORNELL FOREIGN STUDENTS sns1tue4ugTe2dgdheDe,ensaottyesUrdnaHttriohvaelaeclirt,nosfvinwotisyhrtueeemldintgantttiohhnseettwayusidrntaieatsrefnrfitavstnaoebrIetoanhptutaoetCtrrtnaoontrafofnytiiceotelhpln.erfaoolIbrnlSetaetmnurydnseainntthitfoeonOyramfflmiacSateiy,touandhneadtnvhteef.oyOrfIemftiigcaeinys, EXPENSES TUITION FOR STUDENTS not residents of the State of New York the tuition in the Veterinary College is $200 a term, payable at the beginning of each term as printed on the registration cards. T uition is free to residents of the State of New York. The law governing administration of the College pthreovriedgesulathr avtet“enroinatruyiticoonursfeeewshhoallfobreareyqeaurireodr moforae simtumdeendtiapteulrysupinreg­ ceding his admission to said veterinary college shall have been a resident of this State.” COLLEGE AND UNIVERSITY GENERAL FEE For certain services and privileges the University charges students a College and University General Fee of $187.50 each term over and above tIuthitaicoan,. thTehiasmGouenntervaal ryFieneg iisn pthaeiddibfyferaelnl t sstcuhdoeonltss ainnd tchoelledgievsi.siIotnscoant­ tributes toward the services supplied by the libraries, the Clinic and Infirmary, and the student union in W illard Straight Hall, pays a portion of the extra costs of laboratory courses and general administration, and suTppuoirtitsonproagnrdamotshoefr pfheeyssicbaelcormeceredatuieonwahnedn stthuedesnttudaecntitvirtieegsi.sters. T he University allows ten days of grace from the first registration day of each term. T he last day of grace is printed on the registration card which the student is required to present at the Treasurer’s Office. Any student who fails to pay his tuition charges, other fees, or other indebtedness to the TUprrneeisavcseruribsrieetdyr’,spoOerfrfiiwocdehoao,nfdifgtreoancpeti,atyliesdhidstroooptfhpreeered ftefuerisotmiaonndt,heifnaidUlesnbittvoeedrncseliatsiysmwuniittlhesainst ttthhheee Treasurer has granted him an extension of time to complete payment. Fchoarrgsuedchfoerxtleantesiopnaymtheenst tuwdheennt niso aesxsteesnsesdiona hfeaes obfee$n5.grAanfteeed.oFf o$r10fuirs­ ther information, consult the General Information Announcement (ob­ tained by writing to Cornell ETniversity Announcements, Day Hall). Tuition or other fees may be changed by the Hoard of Trustees at any time without previous notice. 21 22 VETERINARY COLLEGE, CORNELL CHARGES FOR MINOR DELINQUENCIES odrtbhu“eufiayirsnmlAyeAAAEteach.rsvsoi’smssstsstemhetoeotruuacrasyfOpmdostldalrfmltelnesfiehlinceytnfcetceuiugtenoetrd”oe,lstnUdsad)tefde,ftanneoesspitcrsitthihdreavhiireoaryiefaisinslinrlrntllUesggauighivnef(dtnteiigiyfdoreetinel:osvdndecttttehotlafruepopkiidslntdafeeeihestiyrasyen$ashcmi’5gonraseis.isnetrneptutfahgrasexrdleheioleaenytgapomnmoilelsrtfrcirt’eanefsitrsrkyi$gaarcap2i.titsucnsioitootcmgnfepnnoosrsauurityboaoanpelfrnftaetaceooascefrfttfnhesuhoedt,adehreiorepuxmeafastnacneay$mdlysroa2aetksfi.brneitflenooaeorjtfrthufiaotetr“trhhynaeetebgfhoodsierdselerolatnTmonrtoatewero”tteihvioasnboeaesngyrrlt­ rfmedtieaxaoaaiAFyalnsdumooeeorsrndeiftsnturoateatdhsoabtesietseoehnocysnettnosoesmmnrdDomdesepriasnlrityetchsirshcsoiiwnsftanmaoglficlracetthyortopooenrafnbtytyhmrceSoeetaaotlwu.krafadeetfeAhigetevaeenupenrtolpdpafltArtaiwiioc$pnodp2aepnm.nteaoirtnoiwiynynnaaitusdsmitfnatrohdyedarousntiivertosifitunrdfytooco.umhraainllthlaytcheahoewserfeaaelitlaqivhtfsuheetitrhroareeesbrdghositovmtsouueterdloaddmettihniceobetann’erls­ LIVING COSTS vfltIeaitixhrrdALBemauUdiocdvaoadnflcik,o’niihsstvrgmia,eosrrriacogntnsaoyoeaisnstmlttydfrrsaoeuaclcaqrmrlhanodubanewdironrngoaeaftoefnrsrsto,dc$,lmeb2iasva5enmiinn$dnstd2cutgoea7ss.rut5te$otpbhMd4otpeeo0melywmin$eaid3siatn2ehsdtw5epteurtteihmhadlfnleoeed.trcnesdoFrtctaosmoslmotorrmaset$fhp3ouigdiet0rnnroenegdgrbtdai,oeroetertasfr$geerra5rdxoivo0as.tmefdel$aLnuc,5atea$ta4eurt1nu2etrn3ad.mp55diwon0.irnnytotycao,mtihddate$eseeon1rnnr,m9iteen5at.gdlhisuniea.­­ FINANCIAL AIDS UNDERGRADUATE SCHOLARSHIPS oawNviaasrnpfaEhervpdSiiEelcocpigsDhcuhrtriaesoYazadnlnerasttsescsris,tns.h-ushioaSpdncirlpte-eoaeuacsnrmdiistddfaeshmiencniowsapditctpslhtlrFeefyioiunebninnsfehtotedadaoorrnsvef.ciaevsnitlDetahldetlietoedUshArncUeniierniniednvafwt,fioreivioyeDlrnelslnaolarisntsywtsoyiucctviHidyhnuaee,ogalnrnllwdaalttp.eishshadt.rTeogigcTsehraahesaehlm.voldreyaueuollamluudaatanreatietttysnee,moqrrt,afeuhascimnemrewyeiaomvennsaelyecletrhhyaitooethssfglleapsrowreaOsfvfnhhfreftiotiricehpcmahdesel TUITION SCHOLARSHIPS vosaeutanfenacTtdnNeahehdrnerieiywnngneuartgararaYuridlsaosaunvtbrteakasyiestlefsuSitanehthcasetaotttoevhufrV.eedy$Eee4ajntt0auuoet0cdtrs,hhitgnhotmwhasertreiheuzyfondaeatcdmeCunsoooalhtftluoyllhenwit.gmhoteeliod.ptfeifrTnadothgchmuneeailustaymessnccnbahhouenoofradllaalobrrwtfsseuhhhcsiiictooppihmosoanmilran,aeurgrtessonthooiabmputwestar,asaietrnweasdaitneadacddriehdninneottgdosaf VALENTINE MOTT KNAPP SCHOLARSHIP yaMsaMStthhiptetdteeuaaTopietrrdtlhurpwctieactihednoistKarleitlstos,n1aaionoo.annawfqnpnIantupnhDluhda,oteaoaclahli’vh0fwwaiiia4tssbdehir.casdiaehfrlhBVcidiontaty.iDyleanptaroKnaigrpiorsccslnehftbititciaaicihecotpltpasoehnpncnreootoesofafcneoafashdtfsptthti.ohaphdetSlehleeamitevrrcuafeseaadaphdcmlncepuiotpunoelfml,itorttciyoopraatA,flhlnetdedtt$htthoim4oiowesf0naich0inacstrihwieoucswsdhfltatbariroyrehtsardlasoiatbspweirtoilhsessietnthcelhalttirboipa,rnlttcdioaobDassketdhhrypeee.oermlmdouaaViafntrlieeadt’cdtshsrloeesrwwmointeocoohutaaniorrgaknckaknnhheel,.­ YSCOHNOKLEARRSSHRAIPCEWAY FOUNDATION tioBny, aanctieonndoowf tehde secxheocluatrisvheipcowmams ietstetaebolifshthede YatonthkeersVRetaecreinwaaryy FCooulnledgae­ 23 24 VETERINARY COLLEGE, CORNELL odtTichnaenhetniestMoCesnsloaeawlyctmlohetieog1nte7hgcw,ertiiot1sthD9ehea6riri0tnaeoc,ceawttebnoodedirlyilbcdoesobaftnteuSeasdswtiuudesafdeneroretddernewdtidtnhhAfoeobadrywimVsthataiahrnilsdeeirsinesntCstcrgiiaohndtomeetiholnaminMtsrsionthostfcoeitptheNt oKlesolahwantnoreasurYhpSlitpodcphrhakmosanclsSaahkMrtoaaserlhtaaeeiarr.pcspusShhpsiteoplu1idf..­­ A.S.P.C.A. SCHOLARSHIP T his scholarship of $300 is offered annually by the American Society fGhoiosr rstdhtaoebnlPeWrseirvniegnWhtti,hoiontweonfPelCar ironufse,lStNyecetowor YAFaonrrimkm.sa,lsf.roImt isbepnaeidfitfrhoomrsefusnhdoswrsahiseeldd bayt itshiTcrhdho-eyseesnacrhbocyllaatshrssehfiVopretiuessreianwadrauyrrdiCnedgollihenigsethffoeaucrustplhtryinaognndtetfhriemnabltaoysiesaaro.mf Tenmeheebde,rresccoihfpoieltahnret­ sStaohrteaisptter,ueddsaeiefdmtneetrnos tngs(sart)oarfadwtuNehadoetiwaoinrnetY.eporTerakshrt,tiisicanunsldchahor(orlcsyl)easirwn,shthaeionpredeswxtgepieldenl ceietnrxatpleoqicrpuoerimnaicenpteipct1ere9an6cci4tnei-.c1NeI9,t6e(5wibs.)Yowpohernok ECAOSOTPEERRNATMIVILEKSCPRHOODLUACRESHRISP CsibucashowepoolTtploaowegehrpgidraieveesesre.vstdanwisitHsdciftovheote-oeanofriclmfwAatsethhorusosesnsosrhostftfihocpiorohyfisaarutothsvitftoistdeusitnam$ad.ua5hneeng0Iidnng0hiitnhenteoiwsgnrtrtsasahdccsbteehhholroeieafs1sortht9Voalmae6cbedge1qtltemr-uie1rsanarbh9dielanee6iuefnrad2dyasdrt,yaiifonnacloCfegarasdoFEtdeflcueleiamlbednarsgrsaseitucseehnnarictywnporiyeamria,ltMarhuob.1asfii9stpllTkis6rhtrih1eysai,festP.nearkanrpocencludnaiedrnuscpsceawotenhsiartndoeess DAVID KENNEDY JOHNSTON SCHOLARSHIPS oscrhUtoonladrsesturhdiptehsnetfsrwoiminll tthoimfe eNVteeotttetirieminJea.rytoHCuseotuylld,eegfneut.sndisn wtheereCoselltegaesidoef Atogripcruolvtuidree LOAN FUNDS VeTtehreinaCryorMneeldl icValetSeoricnieatryy, aAnldumthnei faAmssiloycioaftioDna,vitdheE.NWewrighYtor’k12 Shtaavtee donated funds to the University from which loans to veterinary stu­ FINANCIAL AIDS 25 dahlttoehreereaesneniitdrtfssaonttrfecheraeroenodtmmousebgwroeahgptiehtmphtnehlcaryetydhfeOefuu.ofnsDfreVidcisereaoetsnoehcslfrtieysoiln.tSdraacnSorhbcyftoueySl.dastettruhIunstdhedtseiepinUnsswttnshsaAiuvonadgedlmgrsasoerFiiestniytnaie.isradnetnrAacrteltiehlilaaioalglttnhiAbnebsliseetdeeue.fddotaToerresnhehteaasospapuepdpdllmldifyysuicinnnnufdioogssssrt.­ PRIZES SthoeCmoeernondfeoltlwheUmseneinpvtreirzosefistyparrhiezaeosspbeteonentboegciavowemnapraedteictdoionansnidbneyuraasltbluylde etnnoutsme nobfreotrlhleeodfUfsnutinuvddesersnfitotsyr. CgUDCeooannylmileveprHegaereltasliyiltatl.iy.roeTPnAsrhani.szeneoCfsUouolonnlpopicivweeeensmsr:sewtiontiytlcsl,opbmouerbplteihmstehiatyeiioslmendaayolonibsnleyt oorbebfyqttaushietneusmetddeanuadtntsddtrhoeeefsrsVtethhdieseittVotoiertltCCeeroeiPrnnnrtaieerzrlyel, cDlaatTihllnsaHelehsaasveEnrndeeitnnfcBeibiunrpyOviadinelseRttanheiarDttreywiEindnaBsaNurtaordurpyridndpVoimegerfEonse$Ttpdhp3CrEie0ricoaiR0iofmtnaeIretlpNolttawooAtnbehRmyetrohmYaFmekaoteoaSftufidaCntneihtanHdheleateOodatyiwfLeotitahnAnahraer,.eRdl TISmhyniHihnecegae.Imh,arP.enabisynwIetAnroas1Wrcnot9dhhef4Aeo5wytRl.haeeiDseavlItlrtei,cfnbcwotteorhuaentersphcsthoiaaaes-irwttsyddstaetahraotibdnoerf­ ymeaayr. be deferred, but only one award shall be made in any succeeding ScaTlnyaHrdsasEcauoHsfperO,tihzaReerAeoCCfaowE$ll2aeK5rgd.ete.oWdTtHahhneeInyTsuEeaccololPnynRsditIsoZtinEmoSfme,raeietrsopittrra.iibozeluissohsfetdu$d7b5eynttHos oitnrhaecthefeiKrsg.trWaindhumiatteeinroigft laoyeiriIaatTinnhetnrnnefeHctieaTaaienwombrh1ttErhasaoomei9eeralwemmc0sr(lylma13tGay,ypbm8mhAre.re8aadRunweion9bnzSsdAaraaiiedabppsatlwstoNiaoehtwmtniaecsnmyooTe1oirnide,lalndr9yodtlm.lvp3egoSbebo4eadbcDywdaH)refnoe..ssretdrneEet.oaiUAdhvnsdwoAReipelHafbdtawrMonthyeaosrthmnaohhdtnrpAaaMtaoeueceokftttNdlegfhmmriilo,osnchyeor.bbiansaifcHoyepsoAgnacprwantisOdlnthnhceehoinaeMPoirnltpeftvlhllyiKeaOenDeatbVfrrdhttIgaftusehe.NtoeechanpootCrugiSwedatmfpgliiorrstvlraiytta.ranihPeymnsnhdHnaeaRecieHruassleeyIVnnltaoZAottwireCpiEniUestnomeakesotfgsnxiirtilrpshnoilitemVntevrosfecamagaelrenaacirewrt$tdntesysaue4sneoifnrrPt0a1Ctrirytornack9ioocnuica5ifnlfufinor5lleunotyetlnsylhargis1lsvnvreeAo9iueepdfr3wmnopittrbe4neeooraoar.oetrrftfasyniimroeIitnn-k8Vssimfaoaot9sihevrrGroioynynyyteerf.,,­ 26 VETERINARY COLLEGE, CORNELL suaTtwsuHuadaEreldlnyeJtdAdoaiNrvtEidsthteuMeddeIeinLnndttLsoEodfaRotfhiinPresgRtsIeptZchroiEeznedbooefysfet$a$4rw2.05oirankndipnhaytsshieoicsloonsgudybpjiesrcizta.ewToafrhdi$se1d5prtaionzedthiiess bTeHrsEofJ AthMeEgSraGduOaRtiDngO cNlasBs.E TNhNeEaTwTarPd RisI ZbEasoefd $u4p0onis tohfeferwedorkto inmethme­ cadlneiinnmitcastlosgaihvpuipnmlgyaneevefflieydc.etniSvcpeeleyocifaloltcheaeml aapbnhidalistigysenoisefrlatahliedanrueepsctoihpneisetinhat.e toabhilaitnydloef dthiseeassteud­ ptThrHeacEctilcinAeiNcosNf gEvievtiBenrEginSeaSvrEyidePmnRecdIeZicoEifneoa.bf iTl$ih4tyi0s iinaswcaalwrindaircidaseldbdaisiaengdntohusepiso.pnritnhceipwleosrkanidn afiTniwrHsattEhrpdereiCdczoeHtuoArissRteh$sLe2Ei5nt,SwaponrGafdoRcutOtihrctSeahSl-syemeBcaeoOrdnNidsctDiunpdYreeiznaePtnsRdiswI Zs$huE1or5Sg.r.earnyTkwohfoigsmha neasnltluiaanlnipmprroaifzlisec.sieTnahcryee leDf1Ters9gorHt2.aem0E.bM.lHi1soM8eho9erA6wedRawtbsoYyaPs1arL9oaO2bfe6meUs,qseIuoamSernEsbdotefroDMfPoeOafDatnOhrth.oRoelVoEfgoeytrrhaiP,genRiBunIVsaaZcleAEttefe.rariMIcionNuloaoltrgoyyByre,AoCfaiConntlThdlheEegoMRenVIoeefOarrtteoLormIfOinnhGsa1pirsY9ye0cw7tCwiiofoatenols.­ erpateexrrscipTizuooeehbmnlosestimgoedpysyersonotatucdfonedadteeethdinnoewsctinsoirotuhfowerfxtahhtpghoteheeereheiiamannhpvddeepeoinavrwtdodisdmvo.ouaneflaenltotthrfh(ee$est4heD0bae)eercsDpmthaearwwaytmnoobrreokeknfationwtfhoaefstrhtduPCeedaoddtelhnleeeotpagslaocerhb,gtyymeyiedetaahennrfet,drrauoyBaprisaonacngas­ pWopbTuefoHerrs$prtEuen5odbi0sc,mePoffbioOoftyr,tfUe’tsda3hLt1ienTmm,oRbeuatmeYnllasadbtttieeDncDrrgoIrtSmo.hiEfnapTAntoteeShsrvtieEehitssieotfPonfGiiunRrosroItltrddhZwi-hEseyeeaseeasfkatasw,eyroas,’sfc3ool5tafrh,esesspot.thoasfeebuCVclloiotbsirmnenhydsee.ptldetaTeotnihrrnbdmieygg, iopNnpDfraa.irlJtzp.h.ee,werNcfsocooroanrkmltslheiturashgsetneest­ mcyinoeanakrtsheitdeoreertjcheuodedmgDtmmoeaeebnnne,tdwaosthufiooffntihwcseiielolncntaolypmthpmmeoiientatrwteiteaao,rrsdiuno.ioutTnsa.behleeofcaowtmhaermdiptwatepielelrtsonorsteuabbdme tihmteteamddeaanridfe, PbsTcysHhi toEFhlraeaArstLfeharPicnpHui,tlyAtpy.ePItrotsSoIwanPaamsRliestImyuZg,Ebgeceirhsstaogerfidavtcebhtnyeerb,fthyoeauBnrdtdehot-anybo(erCraesroartdchntlaaehsltls)otwhfCihshionaptphreitarzeseersstobhfeotthw“haanetwAbahylrepdhheiidass FINANCIAL \IDS 27 capable of elevating the prestige and expanding the services of veterinary science in practice, in education, and in its relationship to community, state, and national welfare.” NetaacbotitfaptVhhonosoarpeutreEetrsrehrerptateer’whseWersbeoeaperodorrhlvfwOuineiverciniswbstpScefYaepaahefhlwordstaiiOrdeaiduclhrcrydelretetdttRaeds.hhmbdaeNtbbKeyeiOwanteayoeeotctnbnawnnocacStpderatebA,hsedlsTsmse.peaetstdadctAwtcuepoTmeccaNeowmdToappsobhdfiseieyarnlEngbeeewontsstienyo.whvtisrra.adprneteVeNYsiewtreepldecalEoorwvoohadeterfTbiafirridrkoleovdtleiiEs.bruttnmeSmthyedyRsefpCteieo,benuatuIaonhryatsNsbfseiftirtcopstemlutAoiuVut$behpcdop.r2rRxbeealeiiet5atelehtAYttperi,iclsehd-ceonoaefyre,.catndtr$miMdeeetntt1saeeisari5aubEoonvrdr,ryfsnnedDiptyrtdahtcdouotIlaintehbtMmanbhCrtradseeeeletsAceoi.tasMhhad$pftntLwhEshee1eiruecaeeaVe0dahymoadsSd,c,eolrerOhOtebrgon1eojSfeppeoarCfrftcsorietoirniapceonIcntdbrsehesEoiaotteyeecelAfrftoTtytnoyyirifacpdYsttve,ahreNbpettspcieahhapylPeloeoeynpeeawrSRrn.d3prrtssosesDIt0DeroTimc;pZom.vhsniiihotvEereareAtueerertevhSnoiyastcclyndeesf,tltl,­­ atThnHenEusatallnWydOitnoMg aEofNset’hnSeioAVr UesttXeurdIiLennaI rAtyRfoCYrolalAe.sgVpee.Mcoin.aAlt.hceoPncRtarImiZbpEuutsioo. fn $w5h0icihs aadwvaarndceeds aAtThdHdejumEdsiegnJneiAisdotC,rraObtsiyBtounmdT,eeRnaaAnts sUihncaMovtnihnSseigTdeUNereeDxdwhEibaNYpitToperdrkAopWiSrnitAaatthReeiDsbVysewcthtiehlorleilnabsaDetriyicgrievCccetaoonrlreleaeognrfensuSuwatpluhledyoreiontiorts oainnntdeirnevfsiertcotlaionogudys,adicnicscoelamusdepsil.nisghmapentittsudine fboarctaenridoloegxyp,reespsei/dooitniotelroegsyt, inpatrheoseloargcyh, HEALTH SERVICES AND MEDICAL CARE wopaeidGdpaicHszxtuaarneioeaotcElyOttdnatuiatsevshnAileiisnCloi)dlXedscrde.sLnleala,ai-euGoSnlrbTcdaidivfiethInnHaIycueotnbncfhddlctofytelnu(aeeoshououxecnrenveridtumarrtatnthmetvtiamsterneI-iraencepMbagyiatdtennfhaGnori.iseaoetbecdrtiedthmnahdIeaineinsa.oaneCncaeinyrfmnstaddrrogots,sylaiuleerdtllimrmslrCeaineewigngFpnesldafedeitiuedoagntnetieirirhrccrtioc.atocamyamtanns.nmhTtlp,cuedeseheeeadnucnacudbarltniiaUigi)srfosamccdeo,ilunacaaraitihladsavntevedloereaxdcsereimdsiupvarcalpsaeacirgciiciivecrnbnhnetteeiyaslonss.feelyi,isttoitsnheiTzesGrtsssreoaaehefueartaeoadeirnsCtonrauematonndtichprnhinrcoaalepdneleatslxnlrtteteAiheeClmmFdmfsalentolseuhtauinemIernerGymnon.iaientfcutanIhibn;Fgnnnrdoetetmhofncs;lfiaeereevaraobhfmmtacrbotssoofcyceeetauuraisaMrrndrarprtvvi(ytitettnhiieioehocntceoednaireeeotdnnsyslisssrf­­­ HOUSING FOR STUDENTS UNDERGRADUATE MEN wdaStthhpiteveeeCpswitrdovcoaeraeoxrndlnftiletmeileAtylnhravtetoUtoeeonflnmtyuwittvhaeh2osieee0n,rm0ssca0iocatanyauimmdnmthpeppgC.nururo.saTosvmTuhaipadhpenineeudnsdssagerasaeoR,rdtaevtotorehaiarsrsemdcliot.tbBuiiotvoaToaketukrihe,innedeegrdqseuoGdCadniorreareotbymauyuadpigftoiWofafairrtvmneieLeeeds-isntatm,ok-UaiireUnncnyruintevttoifheevapirecstwslrhioisltaeaiitytltrikyeetnH,oasofararolatftnlhhomrsdee,r. NaMTnHocdrFEtaahfdfBdoBiArnadKksHeEaracRlcHlo, amGilslRm,oOofSdUfoaiuPrteit,ohpnrcosBoofamfokrpcerorainspHespdtrraoullxoc,tifimoMBnaet,aenkElneyner gn6l5Ti0soHhwmacleelor,n,l.lLeFgyoioauntne dHienrasldl,eHsiaagnlnld,, oUpNenIeVdE RinSI1T9Y54 HanAdLLaScc, ocmommopdriasteed 1o3f50Umnietns. 1T, h2e,y3,ar4e, o5f, manodde6r,n wfierree- 28 HOUSING 29 pfarcoioliftiecso. nstruction and offer excellent study, social, and recreational ammeabsBRhmspiitiaUtJtnonoeivbnaadurseeoegnealrgoseClAbdSnmeeninmaei;tnirvveibsceitvosylptthcuaisi,tteefscsaerBtsipioaredeetsnf1omoriwaicelulaaio.olsLeteennlinnaadasktiaenycrndlavutndeseyleaoytakceftrsrisbrtsflufttreoe,nbmiioscaoyesHstdo;mdienCeahnsoc.eenesicacoahetodndtfatnnItgnhuhfchldomtuofctiflutereefeeurn;seodpaaeaopaptaetlrngveareeseOnrrartrdCeqUerabrnasmaov.arnsfaoeiionuinltvniofngdaltesadciolcdaaiwitrcnil,mtesvdeemrvebeeti,fotteeaeghnelelaeodposesitdrotternelrbtorrth:hlsfrs.hoUaofteiioatfoDWoowtsgwoArUoTtcuiynftrhtnrarrtshysdhidnadieiaiaHevtlivmmiriaiehofnlsnlevsfnyteraoennU,ersooyira,eirmmsdtsfmrnntBsdraespseiCesduCgaitiinerrreatriyovahSiviroedotonarnnrnesyaiaEptrrlorinegtrrswnHvrCitnaupcsagueyrpeeydieioiradaatwsnsftdllgoilomnrnyfllaehdvlehehlfeiro.gnnuo,iinaeesmoettlmnm,eutnethaenmrfHUHegmsrfeicddmfitwaateiescooevheoaanntreos;hsahnouesrlr,idnfonlmtiruditsii(,ChocettnmafididhnaesronttsIaciieishemhl;srgtrcsSonfeensueetieepowsti.lsimidcydctottenetmirchssoeeoitnepcccegel.atesrucernltikuonminisiayhrTaftUgiordtualdsenooNbiabnnhepgrenigfoteaeideeodnwseeeenisrpdliynvasrsteasHynhopvemote;pnMufoeinlsgoiarmtlodniosnasibanolcfirgalifpahiaiLnoloauit.looryacntayeetndottsiraniv)aDcydhooedo,rteolwdmfaaneeoirgnbirfnoddaobvaafeaesoibueonVnemtterirluoesihismmsstgrlnottaeebmhiiaiioedoesngnyrnnndyiaelrf­­­­­­­ UNDERGRADUATE WOMEN woUtctaohufnonreAmCdimSdeonstesnedutrroannidogantneeirrpcwiclnanelpsedtisgosllu,lUi.rocaorobnafotrteteiiohivtpoimewesrenrerossosnvaim(tftifrfoysoerotiraronormnpnmuagreaornaelfeevcmdomiherardeebcrencgqeclstiarerusvsnapicidrdtnaooeauirgnmnddealcaytfateateo)oecprcutpwtlbaooinrvybomoleelmvtemstheih,esnedo,enwdUbUbOaeaeyntltnfciltfioaieivtvcnuhfneeeussedrrerssoininfOiftotoiygysffrAf-h.ioectedpuhxedmenecorediadsfpUestotreitniroghdominrevnasdieadtoDrolwusrreimcaiitaetityrhneis.­­ GRADUATE STUDENTS opthpreoSexarcagimateemadHtpeuaalsysll,a2a0nthp0deumbigsleircnacdocaunanavfdeteetnewirecoinaemn.t teetnor., SapalrlgoevcioHdlleaeslgledsio.s rlImotscitaodtreiydninhingoutfshaiencgilcietfineotsreraaorpef­ 30 VETERINARY COLLEGE, CORNELL MARRIED STUDENTS sPatplueCadaroestmrnannteestnl!atGsnU.rdonvitevheewrisriittfhyamp9ir6loievasipdiaenrstmtuhenenftuCsr,onriansnehdleldHQaaupsaabrrtretomrusecknwtisHthfeoi8gr4h4tas0p0awrmtimtahrern2iet4sd6, Detailed information on all types of housing, including off-campus housing for men and married students, may be obtained by writing the Department of Residential Halls, Day Hall. THE CONDUCT OF STUDENTS memAwftbschounoeieTuircUn’ttssnhhtrdeenteiAhuteJmdatyuechLbce.ootdeotLrivniigahoncoerritnitddmbaSiaemdslrtgisiuysufegrerdmisalaoitfeBntytmaeainoioknttnaodnehdtrCfiehdasriroescetneUhndiccpoUeedonaolrcugilinmvlneincinbenavmtirydzrrteesyfeeilroiavadtnsthnrtyciididtaedb’oyafssuyintenaiFrbssioealtferhhn,lseasipaestspraieenhnscicsdmtntrtotiatuaetoaehbtvdnnrChtelieeh.eeeosnewRAotrtmsnbpee.UebesdiaslnisotnnldtuidbnieodsvyynienteneucrnotrtedhesoftaeirefnteJnmuyudsMttntahdsfyFieiieasncanioialceC’afisatuxnrocylpgotamctheynroecrmByreWtdeCosicattdpaoitoonmeremmmcdtecoee;t,­­­ REQUIREMENTS FOR GRADUATION TH E PRESCRIBED four-year curriculum leading to the degree of Doctor of Veterinary Medicine (D.V.M.) is summarized in the section below. To receive this degree candidates must satisfy all the entrance requirements (page 12-16), must successfully pursue the courses named isnpeTtnhhteeawct uolrerrakisctuolfountmheeybeCealoorlwlien,gemreiussisdtaernhracaenv.geepdaitod all fees due, begin late in and must have September and rtoecAcoltrodtssheeainncdoJncuconlnueds. iuoTcnht eooffascetaaudcdheemntetiscr.myUetnahrseaitsVisdfeaitvecrtiodinreyadrysitnuftadoceuntlwttsyowwtielirllmlbsree. vdireowpptehde from the College. THE CURRICULUM In the following summary of the curriculum, the figure in the first column after the name of the course is the num ber of the course and ritnhefeetrhssuectcoseesacsofdnuedlspcaurnirpdstuitoihtniorodfntchooenluseemvonefsrathlinecdofiuocrlalstoeews tiihnnegephitaohgueerrss:teo3rfm3-c.4r6Te.dhiTet hgaeibvbfeirngeuvfrioeasr­ gtiroandu“aRtieoqn.”buintdtihcaattesnothfaotrmaalcocurersdei,t oisr giitvseneqfuoirvathleentc,ouisrsere. quired for FIRST YEAR AANDnneeuvaatterooolommapnyymateo....nm....t..a..y..l......A...........n......a.......t.....o......m............y............a......n.........d............H............i...s......t...o.........l...o.........g......y.................................................. AMPhniycimsroioaslcloogpHiiccuaslbAaCnnhadteormymisy.t.r.y.............................................................................................................................. AAnniimmaall HGeunsebtiacnsd r..y...................................................................................................... Course number 21 7 8 1 11 124 11 T otal ................................................................. 31 C red it Fall term Spring term 7 — —6 —1 4 —3 — —5 6 — —3 —3 20 18 32 VETERIN ARY COLLEGE, CORNELL SECOND YEAR Applied Radiation Biology ....................................... GGSPBBSAAPEPFRpphohhaaxeoenneeyoaccnnypeiiccmsmttrdeneeseeiimiraarirtorraagoaaiQlliilallmoolloelcPouPllngPoeooHPPagaayonlgaglattoaylutihyrhyottagt..sahhooy..gl..ybso..aolaly..aioo..nlnlCt..Ponog..goid....hlo..gdgyy....l..y..nyo..ry....II..ys..tL..gm..m.i..r.....Lo..yo...a......m.ml......alb....o..............b..uo...g.u..............o...nr..y...n............a.....ro.....o.........at......l........ol.....o..t.......o......o.....r.....g.........g.y.......r.......y..........y.y..........................................L........................................a...........................b.................................o...................................r......................a............................t..................o................................r.........................y.......................................................................................................................................................................... Course number 101 132 4 3 03a 0a 1 la 21 485 Total ................................................................ C redit F all te1rm S p rin g term —3 3 3— 4— 52 2 _—___ 2 —3 263 20 23 THIRD YEAR CGSASSSSOFIAADDnpmumuolipeibppfisserronnepsppaaeeggcdtceilllaalliiieclliiiatccrsseeetiaaeelaarAoQdddAllsslilucSnunssAAPEESoOoiuaimamffxxurlnnrDigreer.iaaat.aagePeLrriy.ttl.sslccrenoo.oaei.yiir.Stmmtssuar.CyMoa.egesu.ltl.yysseote..ior.e.rso.ng..yg..d....n....etA..y.....ir........rc........o....n...y....i.......l........n..i................m...........e.....................................a................................l....................s........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 45435222311128023043 463632 201 Req2. Req31. Total ................................................................ 22 22 FOURTH YEAR DJCCulliirsinniesiaicpcssare:uls*dSLAACoemafnnmorccangbLilefellue,laarlraAeAErgytnetonnhcriieimymAcssaan,llimanadls.B...u...s.i..n..e..s..s....M....e..t..h..o..d...s............. 2033252 222200003456 5 Req. 4444 Ret * Clinics will be held all day, Monday through Friday, beginning at 9 a.m., and on Saturday until 1 p.m. DESCRIPTION OF COURSES iIsNgiTveHnE. Ufonldloewr einagchpdageepsaratmlisetnotfhtehaeditneagc, hbirnigefddeepsacrrtimpteionntss ooff tthhee Ccooullresgees mocufafrerrriilecydulfwuomirll;gbraeadffueowautneadr.setuMedloeesnctttisovfeotrhtoessteuvedcteoenrutirsnsaeorsyf aorsetthuaedrepnactosrtlloeogrfesathreeofvgeitvhteeerninUpanrryii­­ vbafAobeeurrTgossneuih,tdntyeise.trihgacneillvinsetphitnacaesrtuetingmacedrueneelneartroraaoplcsfelpirdtneahecitesceicaadolrlpihpwbeetyrioaaordtnskiieonvongoeff,roeafftoalhtclehldhoeewadpcciaelntirpingtvamiicrtthtseime,enswtedsni.oettfhpAactcorhotnbmaucrtrieeseerndfnsteeapsadltanadrdwtteemismnlcleurenmibnptet.­­ otifoFnthisn.eavlleyt,ertihnearrey icsuarrilcisutliunmg .of courses given by other colleges as a part ANATOMY Professors R. E. H a b el, H. E. E vans; Visiting Professor H. P. A. de B o o m ; Assistant Professor A. W. Stin so n ; Instructor A. deL a h u n ta ; Assistant J. A. M. P ierard; Research Associate S. M ik a m i. 1. GROSS A N A T O M Y . First year, full term. Credit seven hours. Lecture, M 9. Conference, W 9. Laboratory, M 10-1, T 10—1, T h 10—1, F 11—1, S 9-12. Professor E vans; Instructor deL a h u n ta ; Assistant P ierard. Prerequisite, course work equivalent to that required for admission to the Veterinary College. A limited number of nonveterinary students will be admitted by permission. The structure of a typical mammal is studied by detailed systematic and regional dissection of the dog. The basic features of avian anatomy are studied by a dis­ section of the chicken. The lectures, supplemented by demonstrations, consider the comparative and regional gross aspects of vertebrate organ systems, anatomical terminology, literature, and techniques, and the specific morphology of the dog. Each student is required to make a deposit of $20 for a disarticulated dog skeleton. 2. GR OSS A N A T O M Y . First year, spring term. Credit six hours. Lecture, M 9. Laboratory, M 10-12:30, W 2-4:30, Th 10-12:30, F 2-4:30, S 10-12:30. Professor H abel; Assistant P ierard. Prerequisite, Anatomy 1 or Zoology 211-212. Regional anatomy of the horse, cow, sheep, and swine. 3. A PP LIE D A N A T O M Y . Third year, fall term. Credit one hour. Laboratory, T 10-12:30 or T h 10—12:30 or S 10-12:30. Professor H a b el . An opportunity for practice in the recognition of those anatomical features 33 34 VETERINARY COLLEGE, CORNELL which are essential to diagnostic, surgical, obstetrical, and postmortem pro­ cedures. T he approach is topographical, comparative, and clinical. T he emphasis is upon the study of living animals, supplemented by dissections, serial transections, models, and radiographs. 4. APPLIED A N A T O M Y . Third year, spring term. Credit one hour. Labora­ tory, M 2-4:30 or Th 2-4:30. Professor H a b el. Anatomy 4 is a continuation of Anatomy 3. 5. N E U R O A N A T O M Y . First year, spring term. Credit one hour. Laboratory, T 10-12:30. Assistant Professor Stinson. A morphological and functional study of the central nervous system of the domestic animals. 6. A D V A N C E D A N A T O M Y . Fall and spring terms. Professors H abel and E vans; Assistant Professor St in so n . Prerequisites, Courses 1, 2, 7, and 8 or similar preparation in comparative anatomy and histology. Hours and credits to be arranged. An opportunity for advanced study under personal direction. 7. D E V E L O P M E N T A L A N A T O M Y A N D H I S T O L O G Y . First year, fall term. Credit four hours. Lectures, T T h 9. Laboratory, W F 2-4:30. Visiting Pro­ fessor deB o o m ; Assistant Professor Stin so n ; Instructor deL a h u n ta . Prerequi­ sites, course work equivalent to that required for admission to the Veterinary College, plus completion of or concurrent registration in Veterinary Anatomy 1 or 9, or Zoology 211. A limited number of nonveterinary students will be ad­ mitted by permission of the instructor. The study of development is designed to provide a foundation for the under­ standing of definitive anatomy, the genetic and functional relationships of the tissues, and reproductive physiology. Students are provided with serial sections of the chick and pig for laboratory use. T he biology of the cells and tissues is illustrated with material taken from the domestic animals. 8. M IC R O S C O P IC A N A T O M Y . First year, spring term. Credit five hours. Lectures, W F 9. Laboratory, M 2-4:30, W F 10-12:30. Assistant Professor S t in ­ s o n ; Instructor d e L a h u n t a . Prerequisites, Veterinary Anatomy 7, plus completion of or concurrent registration in Veterinary Anatomy 2 or 9, or Zoology 212. A limited number of nonveterinary students will be admitted by permission of the instructor. The microscopic structure of the organs and the morphologic evidence of their function are described and illustrated with preparations from the domestic ani­ mals. In the lectures, the relationship of normal morphology to veterinary physi­ ology and pathology is emphasized. 9. V E R T E B R A T E M O R P H O L O G Y . Fall term. Credit three hours. Lecture, W 1-2. Laboratory, W F 2-4:30. Professor E vans. Prerequisite, zoology or biology. Designed primarily for graduate students in animal husbandry, nutrition, con­ servation, and zoology, although undergraduates may register by permission. Pro­ vides an opportunity to dissect the dog, horse, pig, sheep, and cow. Lectures, demonstrations, and student presentations on the phylogeny, structure, and func­ tion of vertebrate organ systems supplement the laboratory work. DESCRIPTION OF COURSES 35 PHYSIOLOGY Professor A. F. Se l l e r s ; Associate Professors L . L. N a n g e r o n i, E. N . B e r g m a n , C. E. Stev en s, R. H. D u n l o p ; Assistant Professor J. F. W o o t t o n ; Acting Assistant Professor J. W. B oy d; Assistants J. A. H im e s, W. E. R o e , F. B. T ie r n e y ; C. S. G ia tta s, Visiting Fellow. The following fields of activity are covered in the work of the department: physiological chemistry, animal physiology, and pharmacology. The department is well equipped for work in these fields. 10. A N I M A L PHYSIO LO G Y . Spring term. Credit three hours. M W F 10. Associate Professor N angeroni. Prerequisites, one year o f biology or zoology and college courses in chemistry. Lectures and demonstrations arranged especially for students of agriculture but open to others. 11. P H Y S I O L O G I C A L C H E M I S T R Y . First year, fall term. Credit six hours. Lectures and recitations, T 8, T h 8, F 9. Laboratory, M T T h 2-4:30. Assistant Professor W ootton and assistants. Prerequisites, 12 semester hours of inorganic and organic chemistry. Includes also the elements of biophysical chemistry. A part of the course is devoted to a study of the normal chemical constitutents of the blood and urine and the quantitative determination of such as have been found most important in physioloigcal and clinical studies. 12. P H YSIO L O G Y . Second year, fall term. Credit three hours. Professor Sellers; Associate Professors B ergm an and N a n g ero n i. Prerequisites, Physiology 11, Anatomy 1 and 2, or Anatomy 9 or Zoology 211-212 and Biochemistry 102. Lectures and demonstrations on blood and lymph, circulation, respiration, digestion, and absorption. 13. P H Y S I O L O G Y . Second year, spring term. Credit three hours. T W Th 8. Professor Sellers; Associate Professor B ergm an and Assistant Professor B oyd. Prerequisite, Physiology 12. Lectures and demonstrations on the muscular and nervous systems. Special senses, excretion, metabolism, temperature regulation, endocrine organs, and reproduction. 14. E X P E R I M E N T A L P H Y S I O L O G Y F O R V E T E R I N A R Y S T U D E N T S . Second year, fall term. Credit three hours. Laboratory, T and Th 9-12:30. A12s.soc(GiarteadPuraotfeessstourdBe netrsg mreagnistaenrd assistants. for Course Prereq 20.) uisites, same as for Physiology 15. P H A R M A C O L O G Y . Second year, spring term. Credit six hours. Lectures, M W F 9. Laboratory, M 10-4. Conference, S 8. Associate Professor D un lop and assistants. Prerequisites, Anatomy 1, 2, 5, 7, 8; Physiology 11, 12, 13, 14; Path­ ology 40, 40a. 17. SPECIAL P R O B L E M S I N C H E M IC A L P H Y SIO L O G Y . Both terms. Hours and credit to be arranged. Registration by permission. Laboratory work, conferences, collateral reading, and reports, adapted to the needs of students. J8, R E S E A R C H . Both terms. Hours to be arranged. For graduates only. 36 VETERINARY COLLEGE, CORNELL 20. E X P E R IM E N T A L PHYSIOLOGY FOR G R A D U A T E STU D E N T S. Spring term. Laboratory, W F 1-4. Associate Professor N angeroni. Prerequisites as for Physiology 12, coregistration in Physiology 13. Registration limited. Con­ sent of instructor required. PHYSICAL BIOLOGY Professors C . L . C o m a r , E. L . G a ste ig e r , J r .; Associate Professors R. H . W a sser m a n , F. W . L e n g e m a n n ; Assistant Professor D. N . T a p p e r ; Research As­ sociates J. R. G e o r g i, A. N . T a y l o r , J . C . T h o m p s o n , J r ., R. A. W e n t w o r t h , R. Z. K o r m a n ; Assistants F. L . H il t z , F. A. K a l l f e l z , P. F. M e r c e r , C. M arcus and H . L evitan. T he department is well equipped for advanced work in the applications of radiation and physical methods to problems of animal and biological research. 100. R A D I O I S O T O P E S I N B I O L O G I C A L R E S E A R C H — P R I N C IP L E S A N D P R A C T I C E . Spring term. Credit four hours. Lectures, T T h 11. Laboratory, M T or W 1:30-5. Prerequisites, a course in quantitative chemistry and permission o f instru Lectur c e to s, r. d e Profe mons tsrsoartioCnos,maanrd and staff. laboratory on the fundamentals of atomic energy procedures and applications to biological research. 101. APPLIED R A D I A T I O N B IO L O G Y . Second year, fall term. Credit one h our. Lec W tur 9es 10. an J. d dRe.mGoenos trrgaetio n s on the nature of radiation, biological effects, veterinary applications, and monitoring procedures. 104. B IO L O G IC A L EFFECTS OF R A D I A T I O N . Credit two hours. Lectures, T T h 10. T o be designated. Lectures and demonstrations on radiation physics, radiation chemistry, radia­ tion effects at the cellular level, radiation effects in multicellular organisms, genetic effects of radiation, radioprotective and radiomimetic substances. 107. S E M I N A R — SPECIAL TOPICS I N PHYSICAL A N D R A D I A T I O N B IO L O G Y . Credit one hour. Fall term. Registration by permission. 109. F U N C T I O N A L O R G A N I Z A T I O N OF T H E N E R V O U S SY STEM . Fall term. Credit three hours. Lectures, M W 10. Laboratory, W 1:00-5:00 bi­ weekly. Prerequisites, physiology, organic chemistry, physics, and/or consent of instructor. Physical chemistry and neuroanatomy desirable. Professor G asteiger. The function of the nervous system will be considered primarily from an electrophysiological viewpoint. Where appropriate, important studies of reflex­ ology, chemical and feedback control, and comparative anatomy will be utilized. Laboratory studies will include electrical activity of cells, reflexes, decerebrate rigidity, acoustic microphonic response, subcortical stimulation, evoked and spontaneous cortical activity. PATHOLOGY AND BACTERIOLOGY Professors P. O la fso n , G. C. P o p p e n s ie k , D. W. B a k er, J. A. B a k er, D. W. B r u n e r , C. G. R ic k a r d , J. H. W h it l o c k , K. M c F n t e e , J. H . G il l e s p ie , J. DESCRIPTION OF COURSES 37 B e n t in c k -Sm it h , B . E. Sh e f f y ; Associate Professor L. P . K r o o k ; Assistant Pro­ fessor N . L. N orcross; Research Veterinarian W . C . W agner; Research Biologist H. O. D u n n ; Laboratory Director T . F. B en so n ; Research Associates L. E. C a r m ic h a el, R. F. K ah rs, L. C oggins; Research Oncologist J. E. P o st; Assistants S. G . C a m pb e ll, B. D . P a tn a ik , G . C . T odd, C . S. L. Hsu, R. A. M enzies, R. B. G lazer, J. M . K eh o e , P . W . M ellic k , H. V a n K ru in in g en , D . A. M orrow , M. T . A. F o u a d ; Visiting Professor S. M. D e n n is . The laboratories of the department are well equipped with modern apparatus providing opportunity for advanced work, for those students who are properly prepared, in pathological anatomy, autopsy work, pathogenic bacteriology, im­ munity, virology, and parasitology. The department operates one diagnostic laboratory for general diagnostic work, to which a great deal of pathological material and many blood samples for serological testing come from all parts of the state. In addition, a teaching laboratory of clinical pathology is operated to service the clinics of the college. These laboratories furnish an abundance of fresh materials for teaching work and for research in animal diseases. The clinics and the routine autopsies also furnish material. The following courses are required in the curriculum of the Veterinary Col­ lege and are given particularly for veterinary students. W hen there is room for them, properly prepared students of other colleges will be admitted, but per­ mission to register must be obtained in each case. 40. G E N ER A L P A T H O L O G Y LEC TURES. Second year, fall term. Credit two hours. M F 9. Professor R ickard. Prerequisites, Anatomy 7 and 8 or equiva­ lent. In addition, it is desirable that the student shall have had at least one year’s work in anatomy and physiology. In special cases of students who are majoring in biology and expect to take no further work in pathology, these prerequisites may be waived in part. W hen this is done, the course will not be accepted as a prerequisite for other courses. 40a. G E N ER A L P A T H O L O G Y L A B O R A T O R Y . Second year, fall term. Credit two hours. Section I, M 10-12:30, F' 10-12:30. Section II, W -10-12:30, S 9-11:30. Professor R ickard. Course 40 must be taken simultaneously or have been completed previously. 41. SPECIAL P A T H O L O G Y LECTURES. Second year, spring term. Credit two hours. T Th 9. Professor O la fson. Prerequisite, Course 40a. 41a. SPECIAL P A T H O L O G Y L A B O R A T O R Y . Second year, spring term. Credit three hours. Section I, T W F 2-4:30, F 10-12:30. Section II, W F 10-12:30, T 2-4:30. Professor R ickard . Course 41 must be taken simultaneously or have been completed previously. Work in hematology is included. 42. INFEC TIO U S DISEASES. Third year, spring term. Credit three hours. M W F 10. Professor P o p p e n s ie k , Prerequisites, Courses 41 and 43. 43. B A C T E R IO L O G Y A N D IM M U N O L O G Y . Second year, fall term. Credit four hours. M T W T h F 1:30. Professors B ru ner and J. A. B ak er. Includes general and pathologic microbiology, virology, and immunology. 43a. B A C T E R IO L O G Y A N D IM M U N O L O G Y L A B O R A T O R Y . Second year, fall term. Credit five hours. M T W T h F 2:30-5. Professors B runer and 38 VETERINARY COLLEGE, CORNELL J. A. B a k er , and assistants. Open to students who have taken or are taking Course 43 or its equivalent. 48. FOOD Q U A L IT Y C O N T R O L . Second year, spring term. Credit three hours. T T h 8, T 10-12:30. Third year, fall term. Credit two hours. F 11, 2-4:30. Dr. T odd and staff. Veterinary inspection to control quality and wholesomeness of meat, meat food, dairy, fish, and poultry products and to study dairy farms and plants in which these products are produced, processed, manufactured, stored, etc. Certain parts of the course are given by members of the Departments of Poultry Husbandry, Dairy Industry, and Animal Husbandry of the College of Agriculture, and the Department of Medicine of the Veterinary College. 62. A N I M A L P A R A S IT O L O G Y . Second year, spring term. Credit two hours. T h 10, 2-4:30. Professor W h it l o c k . Prerequisites, zoology or biology. A systematic study of the helminth and arthropod parasites of domestic animals with particular emphasis on the identification and bionomics of the forms of veterinary importance. 63. APPLIED PAR A SITO L O G Y. Third year, fall term. Credit two hours. Lecture, M 10. Laboratory: Section I, T 10-12:30; Section II, T h 2—4:30; Sec­ tion III, Th 10-12:30. Third year, spring term. Credit one hour. Section I, T 2-4:30; Section II, W 2-4:30. Professors B aker and W h itlo ck . Open only to veterinary students. Prerequisite, Course 62. An organized study of the parasitic diseases of domestic animals with particular emphasis on the features of diagnostic importance. Special attention will be given to the laboratory and post-mortem techniques that are of value in applied parasitology. The following courses are not a part of the regular veterinary curriculum. Courses 6i and i j o are given especially for students in the College of Agriculture. Course anatom y1. 4 9T is he given for those others are for students graduate who and have had advanced no work in pathological undergraduate students. Permission to register must be obtained by all students electing these courses. 61. H E A L T H A N D DISEASES OF A N IM A L S . Spring term. Credit three hours. Lectures, M W F 11. Dr. W agner and collaborators. Not open to first-year students or to those wdio have had no course in animal husbandry. The causes and the nature of the common diseases of livestock are discussed. Emphasis is placed on the prevention and control of animal diseases. 64. ADVANCED W O R K I N A N I M A L P AR A SITO L O G Y. Fall and spring terms. Credit one to three hours, by arrangement. Professors B aker and W h it ­ lock. Prerequisite, Course 62. For advanced undergraduate and graduate students. Special problems concerned with the parasites of domestic animals. 149. P A T H O G E N I C B A C T E R I O L O G Y . Spring term of odd years. Credit five hours. T T h 1:40-5 and S 10-12:30. Professor G il le spie. Includes microbi­ ology, virology, and immunology. 150. L A B O R A T O R Y M E T H O D S OF DIAGNOSI S. Credit one to tlirechours. Hours by appointment. Dr. B enson. Prerequisites, Courses 41a a n d 43a or 149. DESCRIPTION OF COURSES 39 Instructions and practice in the application of bacteriological, pathological, and serological methods for the diagnosis of disease. 151. SE ROLO GY'. Spring term of even years. Credit two hours. One hour, T 2-4:30, and one hour to be arranged. Professor B r u n e r . Limited to eight students, with preference given to graduate students. Permission to register must be obtained before the end of the preceding (fall) term. Includes complement fixation, conglutination complement absorption, hemag­ glutination inhibition, precipitation, neonatal isoerythrolysis, and the antigenic analysis of Salmonella cultures. Prerequisites, Courses 43 and 43a or 149. 152. A D V A N C E D W O R K I N P A T H O L O G Y , B A C T E R I O L O G Y , VIllOI. OGY, O R IM M U N O L O G Y . Fall and spring terms. Credit one to three hours. Hours to be arranged. Professors O l a f s o n , |. A. B a k e r , B r u n e r , R ic k a r d , M c - andF n t e f ., K rook. Properly prepared students may undertake special problems or receive special assignments. 153. H E M A T O L O G Y . Spring term. Credit one hour. W 10-12:30 or 2-4:30. Professor R ic k a r d . Morphological studies of blood, cerebrospinal fluid, transudates, exudates, and urine. Taken by veterinary students as a part of Course 41a. A student examines a cow for mastitis. 40 VETERINARY COLLEGE, CORNELL 154. SE M IN A R . Fall and spring terms. N o credit. Required of all graduate students. Undergraduate students are admitted. 155. P A T H O L O G Y OF N U T R I T I O N A L DISEASES. Spring term. Credit three hours. Lecture and laboratory. Hours to be arranged. Associate Professor K r o o k . Designed primarily for graduate students of nutrition. Prerequisites, 40 and 40a. 156. I M M U N O C H E M I S T R Y . Fall term. Credit three hours. Lecture and laboratory. Hours to be arranged. Assistant Professor N o r c r o s s . Lectures include quantitative aspects of the antigen-antibody reaction, physical and chemical properties of antibodies, mechanisms of hypersensitivity, and the purification of antigens. Laboratory experiments illustrate the phenomena covered in the lectures and familiarize the student with selected immunochemical techniques. Registration by permission. AVIAN DISEASES Professors P. P. J.L e v i n e , F a b r i c a n t , C. I. B o y e r , J r ., M. C. P e c k h a m ; Asso­ ciate Professor B . W . C a l n e k ; Assistant R. L . W it t e r . The department maintains a poultry disease diagnostic clinic at the college and five regional diagnostic laboratories in different parts of the state. These laboratories supply fresh material for teaching and research purposes. Adequate facilities existing at the college and at the poultry disease research laboratory on Snyder Hill provide opportunities for advanced study for properly qualified students. A respiratory disease-free breeding flock and a poultry disease isolation building are available for studies on most of the infectious and other diseases of poultry. 46. DISEASES OF P O U L T R Y . Third year, spring term. Credit three hours. T T h 10, F Required 2-4:30. Professor of veterinary stud eLnetvs.i nDe . isease s of domestic poultry and other birds are studied wth special emphasis on differential diagnosis and control. Fresh and preserved specimens from the Poultry Diagnostic Clinic are presented during the laboratory period. 170. P O U L T R Y H Y G I E N E A N D DISEASE. Fall term, alternate years. (Given in 1961-1962.) Credit two hours. Lecture and laboratory, Th 1:40-4. Dr. W it t e r . Prerequisites, Animal Physiology 10 or Human Physiology 303, and General Bacteriology 3. An introductory course in poultry disease intended primarily for students in the College of Agriculture. SMALL ANIMAL MEDICINE AND SURGERY R Professors oss, Jr.; M E. ed P. ica l LIenoten ranreds, R P. . W T. . H K e ir k rr, ; A J. ssistant A. L o r e P n rofes zen. sors A. M. B eck, G. E. The instruction consists of lectures, recitations, and laboratory work. The small animal clinic furnishes abundant material for instruction in applied therapeutics of these animals, including the surgical as well as the medical. This clinic is run DESCRIPTION OF COURSES 41 as any small animal practice. The students arc assigned to the cases, assist in any operations, and under close supervision have charge o[ the patients. 21. S M A L L A N I M A L MEDICINE. Third year, fall term. Credit two hours. W 10, S 9. Spring term. Credit three hours. Th 8, P' S 9. Professor K i r k , l’rerequisite, Special Pathology and Pharmacology. 22. S M A L L A N I M A L SU RGERY. Third year, spring term. Credit three hours. M T W 8. Professor L e o n a r d . Prerequisite, Special Pathology. 23. S U RG IC A L EXERCISES. Third year, spring term. Credit one hour. M T W or Th 2-4:30. Professor L e o n a r d , Assistant Professor Ross. 24. AD VANCED W ORK. Five or more hours a week throughout the term. Research in medicine and surgery of small animals. Professors L e o n a r d and K ir k . MEDICINE AND OBSTETRICS Professors M. G. F in c h e r , S. J. R o b e r t s , F. H. Fox; Assistant Professor R. B. H i l l m a n ; Field Veterinarians S. D. J o h n s o n , L. E. F ie l d ; Supervising Veteri­ narian The R. S. G course icnj tvhertieer;inMareyd ical Intern medicine, es R. princ C. ipl B es aarntdh oplroamcteicwe , , T. F. D extends aovviesr. the last two years of undergraduate study, the subjects of the second year being dis­ tinct from, and complementary to, those of the first. It includes the constitutional, dietetic, and toxic affections and the noninfectious maladies of the different sys­ tems of organs— digestive, respiratory, circulatory, urinary, cutaneous, and visual of the various genera of domestic animals. It also includes a study of the clinical phases of infectious and parasitic diseases, the disturbances of metabolism and therapeutics of large animals. Our proximity to a large agricultural college and to a well-stocked farming community tends to secure a greater variety of patients than can be had in a large city remote from country flocks and herds. Students take charge of a few unusual cases in the hospital and many routine cases in the ambulatory clinic and keep a complete record of each case. The course also includes instruction in diagnosis. Through the medium of laboratory work students are expected to acquire a methodical system of examination by repeated systematic observations on both normal and diseased animals. The work involves the use of various special diagnostic methods taught in our own and other laboratories of the Col­ lege, such as examination of the blood, milk, urine, and feces, the application of sgro-diagnostic methods, etc. AMBULATORY CLINIC An ambulatory or out-clinic is conducted for the purpose of giving instruction to students under conditions identical with those encountered in private practice. Proper conveyances and equipment are provided, and an opportunity is afforded for observing such diseased farm and dairy animals as cannot be entered in the clinics of the College. The student thereby not only has an opportunity to see cases not readily brought to the College clinic but also assists in handling cases in the same manner and under the same environment as are required of the 42 VETERINARY COLLEGE, CORNELL country practitioner. As the vicinity of Ithaca is largely devoted to dairying, valu­ able clinical material relating to obstetrics and the diseases of dairy cows is available and is extensively used. In addition, two field veterinarians associated w’ith the New York State Mastitis Program are located at Ithaca, and senior stu­ dents are required to accompany and assist them on many field trips dealing with all phases of bovine mastitis. In the senior year a field trip is made to the Hanover Shoe Farm, Hanover, Pa., to study and observe management practices on a large horse breeding farm, and this is a recjuired part of Courses 50, 51, and 52. 50. DISEASES OF L A R G E A N IM A LS. Third year, fall and spring terms. Credit: fall term, five hours; spring term, two hours. Lectures or recitations cov­ ering physical diagnosis, ophthalmology, therapeutics, and some diseases of large animals. Fall term, M T W T h F 8; spring term, F S 8. Professor Fox. 51. OB STE TR IC S A N D DISEASES OF T H E G E N IT A L ORGANS, I N ­ C L U D IN G S T E R I L I T Y A N D A B O R T I O N . Third year, fall term. Credit five hours. Lectures, T Fit F 9, S 8. Laboratory, M or W or T h 2-4:30. Professors R o b e r t s , F in c h e r (abattoir work); Assistant Professor H il l m a n . A general survey of the subject of obstetrics and a thorough consideration of the diseases of the genital organs including sterility, abortion, and other subjects related to preg­ nancy and parturition. Obstetrical exercises, pregnancy diagnosis, artificial insemi­ nation, and other clinical phases of the course are presented during the labora­ tory periods. Further clinical instruction in obstetrics and sterility is given in the ambulatory clinic and at a near-by abattoir in the third and fourth years. 52. DISEASES OF L A R G E AN IM A LS. Fourth year, fall and spring terms. Credit: fall term, five hours; spring term, four hours. Fall term, M T W T h F 8; spring term, M T W T h 8. Professors F in c h e r , Fox; Assistant Professor H il l m a n . Lectures and field trips concerning poisonous plants are given by Associate Professor Kingsbury of the Botany Department. SPECIAL LECTURES During the year, lectures on special topics in medicine will be given by eminent practitioners and teachers of veterinary medicine. These will form a part of the instruction in this department. OPPORTUNITIES FOR RESEARCH The activities of the department, aside from the instruction work, are devoted to research in connection with diseases of cattle, including mastitis, the phe­ nomena of sterility and abortion in animals of breeding age, and diseases of newborn calves. Opportunity is afforded for participation in the investigations by graduate students having acceptable preparation. SURGERY Professors D. D. D e l a h a n t y , A. G. D a n k s ; Assistant Professor R. B. B a r r e t t ; Surgical Internes J. S. K e n n e y , J. P. C o m b s ; Resident Surgeon J. F. L o w e ; Farrier The E. W. instruc L ti oany tcoonn.sis ts of classroom and laboratory work designed to afford training for practice. DESCRIPTION OF COURSES 43 CLASSROOM WORK Course 30 in General Surgery, Course 40 in General Pathology, and Course 31 in Surgical Exercises together constitute a group designed to impart a general knowledge of the principles of surgery, surgical pathology, therapeutics, and operative technique. Course 32, a total of seventy-five lectures and recitations, is devoted to the surgery of the various regions of the body and includes horseshoeing. LABORATORY WORK The laboratory work includes surgical exercises and general surgery. In the course in surgical exercises the student is required to perform most of the impor­ tant operations on horses and cattle. The animal is placed under general anes­ thesia. which is maintained until the close of the period, when the subject is destroyed. The maintenance of chloroform anesthesia for three consecutive hours gives the student valuable experience in the technique of general anesthesia, for which there is a constantly increasing demand. Emphasis is placed on asepsis and antisepsis, arrest of hemorrhage, suturing, and dressing, so that, while acquir­ ing skill and knowledge of the appearance, resistance, and general character of living tissue, the student also forms proper habits in surgical procedure. In general surgery laboratory, most emphasis is placed upon the farm animals, but many basic principles may be adapted to all classes of animals. Subjects taught include restraint, various methods of administering medicines, suturing, bandaging, examination of teeth, examination of the feet, and complete exami­ nation for soundness. CLINICAL SURGERY OF THE FARM ANIMAL A hospital is maintained with facilities for the hospitalization of approximately (i7 patients. There are two operating rooms equipped with operating tables, stocks, diagnostic and therapeutic X-ray equipment, and other conveniences, There is also a farriery with a farrier in attendance. Fourth-year students are in the clinics for the entire day, Monday through Friday, also on Saturday and Sunday morning. Two classes of patients are admitted: special patients and clinic patients. Special patients are examined, diagnosed, and treated by the senior staff members. The students assist and observe. Clinic patients are examined, diag­ nosed, and treated by the residents and students. In the hospital, the student has an opportunity to see, examine, and treat many unusual cases that are re­ ferred to the College by practitioners. Furthermore, the student has an opportu­ nity to study the progress of cases, which is impossible when treating patients on the farm. The cooperation between the clinical staff and the laboratories provides the student an opportunity to study the patient critically and to correlate clinical findings with both the physiological and pathological. Every possible opportunity is given to the student to participate in the examination and treatment of patients because the student will learn more from doing than from observing. 30. G E N E R A L S U R G E R Y . Third year, fall term. Credit four hours. M W 9, F 10; T T h or S 10-12:30. Professor D a n k s and assistants. Prerequisites, thirdyear standing in the veterinary curriculum. 44 VETERINARY COLLEGE, CORNELL 31. S U RG IC A L EXERCISES. Third year, fall term. Credit one hour, M W or Th 2-4:30. Dr. Lowe. Three hours a week of laboratory work in surgical operations upon anesthetized animals. 32. SPECIAL SURGERY. Third year, spring term. Credit live hours. M 1 W T h 0, F II. Professor D f.l a h a n t y . 33. JURISPRUDENCE, ETHICS, A N D BUSINESS M E T H O D S. Fourth year, spring term. Credit one hour. F 8 . Professor D a n k s and associates. Lectures by a lawyer on the subjects of the expert witness, jurisprudence, and civil law; lectures by one trained in business administration on the subjects of accounting, business methods, etc.; and lectures on various practical subjects such as registration, selecting a place to practice, advertising, ethics, etc. 37. F U N D A M E N T A L S OF R O E N T G E N O L O G Y . Second year, spring term. Credit one hour. T h 11. Assistant Professor B a r r e t t . Technique of operation of modern equipment, X-ray protection, darkroom procedure, and fundamentals of diagnosis. THE CLINICAL COURSES Professors F in c h e r , O l a f s o n , L e o n a r d , D a n k s , D e l a h a n t y , L e v in e , R o b e r t s , K ir k , R ic k a r d , F o x , B e n t in c k -S m i t h , F a b r ic a n t , P e c k h a m ; Assistant Professors B a r r e t t , B e c k , H il l m a n , Ross; Research Associate K e n n e y ; Medical Internes T h o m s o n , L o r e n z e n , B a r t h o l o m e w , D a v is ; Surgical Internes K e n n e y , C o m b s ; Resident Surgeon L o w e ; Supervising Veterinarian G u t h r ie ; Field Veterinarians J o h n so n , F ie l d . The practical application of the student’s basic knowledge of veterinary medi­ cine to the clinical diagnosis and therapy of disease begins in the third year of his course. During that year he is required to take Clinical Orientation, which introduces him to clinical work largely as an observer. His intensive training in cwlhinicichalis mdeevdoicteinde toanadctusaulrghearnydbliengginosf pinatiheinstsfouunrdtehr yceloasre, stuhpe ergvriesaiotenr opfamrtemof­ bers of the clinical staff. T he technical instruction is divided among four depart­ ments as follows: T he Ambulatory Clinic is operated by the Department of M edicine and Obstetrics. The Consulting Clinic is operated by the Department of Surgery. T he Small Animal Clinic is operated by the Department of Small Animal Medicine and Surgery. T he Poultry Clinic is conducted by the Department of Avian Diseases. The work in autopsies and clinical pathology is conducted by the Department of Pathology and Bacteriology. Information about the respective clinical divisions will be found under the course announcements of the departments concerned. Only students who have completed the first two years of the veterinary curriculum will be admitted to any one of the clinical courses. bleStfuodregnrtsadmuuatsitonco. mplete all prescribed clinical courses satisfactorily to be eligi­ 201. C LINIC AL O R I E N T A T I O N . Throughout the third year. Fall term, M W 11; spring term, M T W T h 11-4:30. Professor L e o n a r d in charge. DESCRIPTION OF COURSES 45 Methods of clinical examination will be demonstrated, and selected cases from all the clinics will be presented and discussed. 202. C LIN IC AL CONFERENCES. Third year; spring term, F 12-1. Throughout the fourth year; fall and spring terms, F 12-1. Assistant Professor B e c k in charge. These conferences will be attended by all members of the fourth-year class and by staff members representing not only the clinical but the preclinical or basic sciences as well. Students will be required to present reports on their studies of selected cases from the clinics, and these will be criticized and discussed by the students and faculty members. In this way special knowledge and viewpoints of the anatomist, biochemist, physiologist, pathologist, bacteriologist, and para­ sitologist, as well as those of the clinicians, will be brought to bear on problems of diagnosis and therapy. 203, 204, 205, 200. CLINICS. Throughout the fourth year. Credit four hours each. Daily by assignment, including nights and Sundays when necessary. Professors L e o n a r d , D e l a h a n t y , F in c h e r , B e n t in c k -S m it h respectively. During his fourth and final year the veterinary student is required to spend his time, after 9 o’clock daily, studying and ministering to the ailments of patients. He is on call, night and day, during the entire year. For this reason he is not permitted to carry extra academic courses, and outside part-time employ­ ment is not accepted as a valid excuse for failure to meet his full responsibilities in these courses. Under a plan of rotation, students are required to work in groups in the four clinics so that they may acquire a varied experience. Work in one of the clinics may not be substituted for that in any of the others. Work in clinical pathology and autopsies will be supervised by the Depart­ ment of Pathology and Bacteriology. As a part of their clinical duties, students will be required to carry out, under the supervision of the clinical pathologist, such laboratory procedures as are indicated. If the patient dies, the same students who attended him during life will be required to conduct the autopsy and to make any pathological, bacteriological, or biochemical tests that are necessary to provide complete information on the nature of the disease, the reasons for failure of the therapeutic procedures used, and the cause of death. COURSES IN THE VETERINARY CURRICULUM GIVEN BY OTHER DIVISIONS COLLEGE OF AGRICULTURE 1. A N I M A L H U S B A N D R Y . Introductory Animal Science. F’irst year, fall term. Credit three hours. Lectures, W F 10. Morrison 146. Laboratory, T T h F 2-4:30 or W 11-1. Livestock Pavilion. Assistant Professor E l l io t and assistants. A course designed to acquaint the beginning student with the development, scope, economic importance, problems, and language of the livestock industry. All commercially important classes of farm animals are considered, with emphasis on dairy cattle, beef cattle, sheep, and swine. The place of the biological sciences in a rapidly changing animal agriculture is stressed. The intent of the course is 46 VETERINARY COLLEGE, CORNELL to give insight into opportunities in the field, and to serve as an introduction to subsequent specialized courses. 11. A N I M A L H U S B A N D R Y . T he Principles and Practice of Animal Feeding. First year, spring term, and second year, spring term. Credit three hours. (Two hours credit given if taken after Course A.H. 10. In these instances, only the first half of A.H. 11, which deals with nutrition, need be taken. T he second half of the course is devoted to applied feeding.) M W F 8 . Professor R e id . Consideration is given to the basic principles of animal nutrition, nutritive requirements for various body functions, composition and nutritive value of feeds, and the formulation of animal rations. Special emphasis is given to nutri­ tional problems relating to animal health. 124. P O U L T R Y H U S B A N D R Y . Animal Genetics. First year, spring term. Lectures, T T h 9. Rite discussion, W 2-4:30. R 300. Credit ic e 300. three hours. Professor H utt. Problems and Principles of genetics; sex determination and sex linkage; inherited characters in domestic animals, with special reference to lethal genes and genetic resistance to disease; progeny testing; inbreeding and crossbreeding. DEPARTMENT OF MILITARY SCIENCE The advanced Army RO TC Course is an elective open to those veterinary students who have credit for two years’ basic Army, Navy, or Air Force ROTC, or who are veterans. The course requires attendance in three morning classes for one semester of each of the junior and senior years. During the other semester of the junior and senior years, the student substitutes a three-hour academic course in the field of communications, science, political theory, or psychology for credit in the ROTC program. In addition, two afternoon hours per week (2-4 T, W, or Th) during each semester of the junior and senior years are devoted to drill formations and leadership studies. CAREERS FOR VETERINARIANS TcsttereiyHnarv,ceEih.cteoTersFshs,UefuoaNpCrnpCdoloalTrlrbeteIogsOrpeeaNauttrbohclruhoiyscf wastheonherrdevakeledsVtrhostemotipeneprrsoirttngohiacrtereayacmsntcsCiit,mehoneaalcllneeshdg.eaeantloditsh aptoroetfr fottohrfraemvi nleitvetpehrsrietanocacntrkieytcioiemnsndseeaurdrssyi,­­ An examination for thyroid function with radioactive iodine. vdgTtlaihnreefhoeeTnmdoasthestiraloeceeynwonq.dwnuhviOosnhoiecrfngotiiehenedrcaangiicasrvnteeiareasoeanrtuegsrayerssoen.sennmlTsugdaoeiebohfrnvdvmieeadoiiclcnicywabeniamlegoticiunraopokistlnnrmeusota.oraeefelflerLlstewysemtissenketidoeioastiinlsinitmvnrhreaoyoitwthgtfsihfaoetoaeesrnrrmodsdawuieeaasveoddng.xeridnkctcTboeaeysdhrlhliileeasnecad,vnaanciertrtcoireaaemtaeothnardippes,otempenhqisonteuuarssntattaiiiutstnst,ieinfcnoaaeiatntcieninwtleidiclvtosaioagynpimresfiroenooeeasrfft.­ 47 48 VETERINARY COLLEGE, CORNELL serving a useful purpose. Some of the opportunities for veterinary grad­ uates in the U nited States are described below. PRIVATE PRACTICE V eterinary practice is a w ide field w ith excellent o p p o rtu n ities for wellqualified persons. Practice m ay be (a) general, in w hich the indiv idual offers his services in dealing w ith all species of anim als; (b) restricted to sm all anim als, in w hich only pets are treated; o r (c) specialized, in w hich practice is lim ited, for exam ple, to diseases of po u ltry , diseases of horses, diseases of cattle. A bout tw o-thirds of the graduates of veterinary col­ leges becom e private practitioners. SALARIED POSITIONS A bout one-third of veterinary college graduates obtain salaried posi­ tions. T h e m ajority of these are w ith the federal, state, county, and m unicipal governm ents; the rem ainder w ith private corporations. PRIVATE CORPORATIONS M any veterinarians are em ployed by the large m ilk com panies, by large stock and poultry farm s, and by industrial laboratories that produce biologicals and pharm aceuticals for the prevention and treatm ent of diseases. GOVERNMENTAL AGENCIES AGRICULTURAL RESEARCH SERVICE, U.S. DEPARTMENT OF AGRICULTURE T his Service em ploys m ore veterinarians than any other single agency. T h e w ork is concerned for the m ost p a rt w ith th e p rev en tio n , control, and eradication of dom estic and foreign infectious and parasitic diseases of m ilk- and m eat-producing anim als. T h is Service also is responsible for assurance of safe, w holesom e, and accurately labeled food products of anim al origin. R egulatory veterinary m edicine, based upon sound veterinary m edical knowledge, supported by effective legislation, is p lan n ed an d carried o u t in ways th a t w ill achieve the desired results while interfering least w ith the econom ic life of the com m unity and nation. M any veterinarians in this Service are engaged in full-tim e research program s on diseases of anim als of econom ic im portance in well equipped laboratories under the direction of the A nim al Disease and Parasite Research Division. VETERINARY CORPS, U.S. ARMY AND U.S. AIR FORCE V eterinarians who are physically qualified m en and graduates of veteri­ nary colleges acceptable to the Surgeons G eneral of the U.S. A rm y and CAREERS 19 U.S. A ir Force and w ho elect to go on active duty are eligihle to m ake application for appointm ent. Q ualified candidates are appointed in the grades of first lieutenant to colonel inclusive, the grade being determ ined by the age, professional experience, and professional qualifications of the applicant. THE U.S. PUBLIC HEALTH SERVICE T his Service em ploys veterinarians in the developm ent and adm inis­ tration of program s concerned largely w ith the control of dom estic and foreign diseases of anim als transm issible to m an. T h e Service cooperates extensively w ith international disease control agencies as well as w ith our state governm ents. In addition to m aintaining active program s in research laboratories of its own, the Service engages in diversified con­ tractual research program s w ith num erous academ ic institutions. STATE GOVERNMENTS Every state has a state veterinarian or sim ilar officer, usually in the departm ent of agriculture, whose duties are to look after the health of anim als by enforcing laws and regulations draw n for this purpose. In m any states the state veterinarian has a corps of assistant veterinarians. M any state health departm ents have one or m ore veterinarians on their staffs to advise on anim al diseases that have significance in hum an health and to investigate outbreaks of such diseases. Alm ost every agricultural school has a veterinary departm ent. Some of these em ploy five or six veterinarians as research w orkers and teachers. T h e veterinary colleges of the country have staffs of tw enty or m ore veterinarians each. T eaching opportunities are num erous in every field of veterinary education. MUNICIPAL GOVERNMENTS M ost cities em ploy graduate veterinarians on a full-tim e basis, and m any towns and villages on a part-tim e basis, as m em bers of their health departm ents. T he duties of these m en usually are connected w ith the sanitary control of m eat and m ilk. LEGAL REQUIREMENTS FOR PRACTICE B EFO R E one can practice veterinary m edicine in the U nited States he m ust obtain a license from the state or states in w hich he locates his practice. T h is license generally is issued by the d ep artm en t of education or the departm ent of agriculture on the basis of an exam ination set by a veterinary licensing board. Some states issue licenses w ithout exam ina­ tion, by reciprocity w hen the applicant has been licensed in other states. Inform ation about the licensing laws of the various states can usually be obtained by directing a letter of inquiry to the departm ent of agri­ culture or the state veterinarian in the state capital. In N ew Y ork the licensing agency is the State E ducation D epartm en t, Albany, New York. E xam inations are given twice a year. A pplicants are required to furnish evidence of adequate preprofessional as well as pro­ fessional e d u c a tio n , o f goo d m o ra l c h a ra c te r, a n d o f b e in g at least 21 years of age. A pplication for the exam ination m ust be filed at least 30 days before the scheduled date and m ust be accom panied by a lee of $40. STUDENTS GRADUATE STUDENTS, 1961-1962 Adams, Eugene W., D.V.M., M.S., Jainudeen. Mohamed R., B.V.Sc., M.S.. Ph.D., Tuskegee, Ala. Peradeniya, Ceylon Balzano, Frank, B.A., Cortland Kahrs, Robert E., D.V.M., Attica Barber, T. Lyn, D.V.M., M.S., Orient, Kennelly, James J., B.S., M.S., Farm- L. I. ingdale Belman, Anita L., B.S., M.S., Jamaica Estates KeOnknleay., Robert M„ D.V.M., Stillwater, Benjamin, Stephen A., B.S., New York Koenig, Johanna G., B.A., Oneonta City Kumar, Ashwani, B.Sc., B.V.Sc., M.V. Bernard, Rudy A., B.A., M.N.S., Ph.D., Sc., M.S., Aligarh, U.P., India New York City Lee, Robert Chung Tao, B.S., Ph.D., Bokelman, Delwin L., B.S., D.V.M., Taiwan, Republic of China Southold Loesell, Russell W„ B.S., M.S., Ypsi Bucknor, Arthur J. E., B.Sc., New lanti, Michigan Town, Ghana Campbell, Samuel G., M.V.Sc., B.V. LoNw.e,J.'John E., D.V.M., Morristown, M.S., M.R.C.V.S., Crieff, Scotland Coggins, LeRoy, B.S., D.V.M., Thomas- MaCrictuys, Carol S., B.S. M.S., New York ville, N.C. Cummings, John C., D.V.M., Rochester Marks, Edwin P., B.S., M.A., Ph.D., Grosse Pointe, Michigan Das, Krushna M„ G.B.V.C., P.G., M.S., Ph.D., Orissa, India MeBnezaicehs,, REloab. ert A., B.S., M.S., Miami de Lahunta, Alexander, D.V.M., Dryden Mercer, Paul, D.V.M., Guelph, Ontario, Doney, Ronald C., B.S., M.S., Franklin, Canada Idaho Mitchell, Joseph C„ B.S., M.S., B.M.S., Fouad, Mohamed T.A., B.V.Sc., M.Sc., Albany, Ga. Cairo, Egypt Morrison, Adrian R., Jr., D.V.M., Gates, Joyce D., B.A., West Hartford, Waterville, Me. Conn. M ullenax, Gharles H., B.S., D.V.M., Georgi, fay R., D.V.M., Brooktondale M.S., Kittredge, Colorado Georgi, Marion E., D.V.M., Brookton­ dale PaOtnraisiksa,, IBnadsiua D„ G.B.V.C., D.V.P., Giordano, Anthony R., B.A., D.V.M., Glen Head Pierard, Jean A., D.V.M., St. Hyacinthe, Quebec, Canada Gupta, Ras Behari, B.V.Sc., Jhansi, Reardon, John J., B.S., A.M., Ph.D., India Reseda, Calif. Henzlik, Raymond E., B.S., M.S., Ph.D., Lincoln, Nebraska Ryan, Roderick K., B.V.Sc., M.Sc., Sydney, Australia Hillman, Robert B., B.A., D.V.M., M.S., Kelsey SaVncehneezz,ueLlauis, D.V.M., M.S., Caracas, 52 VETERINARY COLLEGE, CORNELL Scheer, Edward W., Jr., B.S., M.A., Tripathy, Sashibhusan, B.Sc., M.S., Milton, Mass. Orissa, India Squire, Robert A., B.S., D.V.M., Fair- West, Keith P., A.B., M.A., Broomall, Strhaanvdebne,rgV,t. John D., B.S., Nelson, WPilali.ams, Raymond C., D.V.M., M.S., Minn. Ph.D., Tuskegee, Ala. Tasker, John B., Jr., D.V.M., Hillsboro, Witter, Richard L., B.S., D.V.M., N. H. Orono, Me. Todd, Glen C., B.A., V.M.D., Crawford- Wright, Jeremy N., B.vet. tried., M.R.C. ville, Ind. V.S., M.S., Worcestershire, England FOURTH YEAR, CLASS OF 1963 Bastian, W illiam Robert, Williamsport, Pa. Breitenstein, James Carl, Delanson Carr, Robert Michael, Brooklyn Castellano, Vincent P., Brooklyn 23 Chrisman, Alan Michael, Sands Point Christensen, Edward Fenner, Fayette­ Covbiullren, Richard Hamblin, Rutland, Vt. Corselius, N eil Palmer, Clark’s Sum­ mit, Pa. Covitz, David, Great Neck Dale, Thurston, Hope, R.I. Donawick, William Joseph, Watervliet Driscoll, Peter Alfred, Bronx Fairbairn, John Robert, Jr., Arkville Feinberg, Edward, Yonkers Grew, Nathaniel, Dover, Mass. GHrairetsr,icCkh, rDisotinaanldLWourias,y,FRluoschhiensgte5r8 Heacock, Noel, Trumansburg Herr, Donald Maurice, Refton, Pa. Jacoby, Robert Ottinger, West Hemp­ stead Jeffrey, John Richard, North Plainfield, KeNss.iJn.ger, Joseph Ross, Farmingdale Lane, Thomas John, Manlius Lohmann, Judith, Valley Stream Lormore, John Forest, Lowville Mather, Melvin Foster, Cazenovia Mayhew, Ronald Frank, Rensselaer Falls Merritt, Alfred Manning, III, Belfast, Me. Miller, Ronald, Yorktown Heights Moore, W endell Stanton, Jr., Roslyn Heights Neilsen, Daniel Holmgren, Brooklyn Osofsky, Norman Nathan, Boston Cor­ ners Palo, Matti William, Greenfield Center Penhollow, Elowyn Raymond, Lake­ wood Powell, Frank Ryman, Fredonia Reif, John Steven, Flushing 55 Reynolds, W illiam Aden, Athens, Pa. Robinson, George Wiley, New York 60 Scheld, Arthur Emil, Clinton, Conn. Schuerger, Raymond J., West Hemp­ stead Schwartz, Anthony, Flushing 66 Sellick, Gene Willard, Schoharie Sheehan, Richard John, M ilton, Mass. Smith, Alcott Leete, Bellows Falls, Vt. Spink, Harry E., Attica Starr, Durward Wayne, North Troy, Vt. Stenzler, Anton M., New York Swartz, Theodore Lynn, Bellevue, Ohio Taylor, Donald O., Morrisville Tiekert, Carvel Gordon, Darien, Conn. Westbrook, Robert Lincoln, Port Jervis Wing, Patricia Ann Corwin, Clifton ZeSnpt,riWngaslter W illiam, East Aurora Zymet, Carl Leo, Endicott STUDENTS 53 THIRD YEAR. CLASS OK 196T Baker, Karl George, Kenmore Keenan, Laurence Thomas, Copenhagen Bartfay, Joseph Valentine, Rensselaer Keller, Robert Eugene, Vernon Center Barua, Reuben Daniel, Kiambu, Kenya Lansing, W illiam Edwin, Albany Baum, Alan Carl, Brooklyn Leonard, John Lynn, Forest Hills Belden, James Sheffield, Fredonia MacKenzie, Neil Alben, Boylston, Mass. Benjamin, Stephen Alfred, New York Meerhoff, George Ellsworth, Clymer Berger, Charles Jay, Bayside Montali, Richard James, New London, Boehringer, Bruce Taylor, Buffalo 16 Conn. Brown, Walter Ray, Peach Bottom, Pa. Morey, Peter Lloyd, Lexington, Mass. Bryant, Everett Sanford, Union, Me. Munson, Reverdy Leigh, Rochester Burleigh, Gary Lee, Snedekerville, Pa. Nestved, Arthur Jack, Ripley Campbell, Joseph, Newburgh Nydam, Charles William, Oneonta Cruden, Janet Elizabeth, Berea, Ohio Olson, Carl Thomas, Selkirk Dorney, James Michael, Pleasant Valley Pettit, Thomas Harry, Port Crane Dube, Leo Robert, Hudson, N.H. Quinn, Charles Barry, Dewitt Dudley, George Clayton, Jr., Auburn Radcliffe, Harold Jackson, Auburn Edwards, Nathan Joel, Water Mill Robison, Milton Alexander, East Wal­ Eisner, Edward Rothschild, New York lingford, Vt. Engstrom, David Stanley, Wallingford, Rymph, Donald Ernest, Greenwich Conn. Scanlan, Gerald Gerard, Altamont Ettinger, Stephen Joel, Rego Park Schloeder, Paul Joseph, Long Island Evans, Wayne O ’Dell, Collins City Fackelman, Gustave Edward, South­ Sidler, Mary Christine, Rochester ampton Smith, Avery Leete, Bellows Falls, Vt. Frank, Richard Arthur, Goshen Strandberg, John David, Nelson, Minn. GFurdouent,s,AJloahnnJaHceonbr, yW, DateearrbuPrayr,kVt. Trewick, Edward George William, Kingston, Jamaica, B.W.I. Haberle, Albert John, Purdy’s Station Johns, Dan Earnest, Conneautville, Pa. TuNrn.Her. , Benjamin Frank, Durham, Kaplan, Meyer, Laurelton Katz, Michael Lincoln, Flushing Wenger, Daniel Martin, Goshen, Ind. Whitefield, John William, Staten Island Kaufman, Robert Paul, Rochester, Pa. Wright, Roy Lee, Mineola SECOND YEAR, CLASS OF 1965 Balogun, Peter George Tunde, Benin & Auchi, Nigeria Barber, Dwight Beecher, Hamden, Conn. Bartholf, Lawrence Wilbur, Batavia Bistner, Stephen Ira, New York 24 Braide, Victor Bowerson Chase, Enugu, Nigeria Braun, Robert Kenneth, Clinton, N.J. Burgett, Anthony Charles, Edinboro, Pa. Campbell, Robert Colby, Woodsville, N.H. Cone, James Fenton, Jr., Cold Spring Cox, Victor Stuart, Jr., Wayne, N.J. Dedrick, Robert Stanton, Tuckahoe 7 Faivus, Jeffrey Bruce, Huntington Gordon, Edward Ira, Oceanside Graham, David Lee, New Canaan, Conn. Hall, Edward Gurden, Johnson City HHaaymdmeno,ndD,aDviadviWd iBnastirodn,, FAourbt uPrlnain Hayes, Kenneth Cronise, Guadalupe, Calif. Hertzendorf, Irving Isaac, Laurelton 54 VETERINARY COLLEGE, CORNELL Higgins, Jerome Brion, Midlane H ill, Richard Albert, Centerdale 11, R.I. Hull, Bruce Lansing, Ravena Jacobson, Robert Joseph, Wallkill Kahn, Donald Edward, Flushing 55 Kamau, George Gikanga, Kiambu, Kenya Kopec, John David, Lackawanna Lamb, Lawrence Allan, W hitestone 57 Lange, Richard Carl, Jamaica 32 l.egler, Robert James, Albany Leslie, John Allen, Ramsey, N.J. Loew, Franklin Martin, Syracuse MacLeod, Ian Fullerton, Ithaca Meader, Charles Pennell, Waterville, Me. Morse, James Royal, Staatsburg Muddell, Clifford George, Madison, N.J. Mullaney, Thomas Patrick, Corning Peddie, James Frederick, Montours- ville, 1’a. I’oggi, Louis Richard, Engelwood, N.J. Proskine, Tyler Robinson, Oxford Pulver, Robert Irwin, Phelps Reeve, Linda Dixon, Riverhead Reiter, Martin Bruce, E. Meadow Rind, Brian Irwin, Stone Ridge Savage, Edward Lee, Summit, N.J. Sbarra, Jeremiah Nicholas, Garden City So. Scherzo, Carmen Albert, Kearney, N.J. Schoemann, Ralph Samuel, Owego Schwartz, Alan Elliot, Yonkers Shapiro, Martin Paul, New York Sharp, Ronald Kay, Omaha, Nebraska Stokes, Mark Holmes, Mahopac Streett, John Walter, Jr., Ghent Terry, John Melvin, Oceanside Thackaberry, Richard Gerwin, Doug- laston Thoma, Richard Edward, Canastota Thomas, James Dale, Cortland Tremper, Wayne Evan, Campbell Hall Viet, Hugo Paul, Altamont Whitlock, Robert Henry, Troy, Pa. FIRST YEAR, CLASS OF 1966 Adams, Randolph Martin, Hingham, Mass. Alberding, Robert Milton, Waterville Anderson, Glenn Arnold, Flushing 65 Andresen, John Edward, Wappinger Falls Basciano, Peter Stephen, Flushing 66 Beck, Gary Fred, Hillsdale Burke, Jack, New Rochelle Bushnell, Richard Warner, Manchester, Conn. Cady, Errol John, Valley Falls Cain, Gary M., Brooklyn Christopher, Arthur William, Brent­ wood Collins, Donald Ray, Berwick, Me. Conway, Danice LaVerne, West Mon­ roe Deitchman, Jonathan, New York 63 Dwyer, John Alois, Buffalo 6 Fernandez, Goeffrey LeRoy, South Dartmouth, Mass. Fowles, Wayne Joel, Southampton, Mass. Gambrill, Raymond III, Highland, Md. Garman, Robert Harvey, Hastings-on- Hudson Goldstein, Norman Harold, Dewitt Hansen, John Peter, Ballston Spa Harris, Margaret Ann, Auburn Harvey, Gale Howard, Saxonburg, Pa. Herzig, Lee James, Beechhurst 57 Hess, Frederick Fleming, Millerton House, James Anthony, Auburn Johnson, David Harold, Nottingham, Pa. Jones, Thomas Richard, Elma Jordan, Elizabeth Katherine, Astoria 6 Kennett, Paul Donald, Methuen, Mass. Lacroix, Jeffrey Alan, Easton, Conn. Mach, Frederick Paul, Cheshire, Massa­ chusetts Malungu, Josaphat, D. K., Uganda, British East Africa Moorhousc, Arnold Sydney, Westerly, R.l. Mountan, Paul Christopher, Yorktown Heights Nelson, John Hjalmar, Jamestown Newman, Harry Samuel, Buffalo 1(5 Nilles, Bernard John, Pittsburgh 37, Pa. Nowak, Edward Joseph, Hamburg Paeplow, John William, Snyder Palin, Charles Herbert, Jamesville Pescod, Thomas Richard, Wantagh Platt, Kenneth Bradley, Cranbury, N.J. Pollack, M elvin Gene, Union City, Pa. Reese, David George, Pine City Rosenzweig, Jack Leslie, Deer Park, N.J. STUDENTS 55 Sancho, Victor, Georgetown, Britisli Guiana Scribner, Peter Lowell, Portland, Me. Silverman, Jerald, Brooklyn 19 Smith, Ernest Karl, Merrick Swift, Robert Lenord, Webster Tarr, Benjamin Dale, Gradyville, Pa. Thomas, Charles Leonard, Frackville, Pa. Usborne, W. Ronald, Rochester Ward, Jerrold Michael. New York 62 Witmer, John Ralph, Webster Wolf, Martin, Yonkers Wolfe, David August, Barker Youmans, Ray Sedric, Jr., Andover, Mass. Zimber, Charles Paul, Rochester 20 INDEX AAAAAABCCCCCCEDEFFFGGaiaxdalocvunndnoouorrnicrarpmuiaiaavmntnnruamaelrudretrddaoiddbanneioisblcennsuucuiutlnrecmamisnsyPecsuaaDncsncileig,earttolyticeesRfiiaeeudCcls3sne,,nodocmeeRmoAsSr2Ca3SftSag,1COiu3net,tsViScateiuurd1eadqosetln3std2eds,nhetuuu1et,rtyFeRnd2sersideas,4rn,3,adrireteeen0tici1La4nqCsmsongi64r,,tilunao,,ssie51itr,l,tinr1il19ineee6a31otssg0m9snf,i.,esdes9I,1e,nn244tsf7sr5i,doen13tbcaocvkecrover GLLHHLOHMMPPPRShhceoaieobriebeighstyyaasaljuhdrteioansesdlosatoiiilctasluaicorrchal,tnryryRiaoalsrcnyg2o,s,ltgSheoe3i,gh9ye9BoSqfyi2Fr&cnpuiv,8I&aoisinieO3crlRcnsoB5e&iebletcgmsaiiseqPt,ytcti,ueu,ree2tni4eti8ts3zirr6rt,6oeieisco9sn,m,sl,5o,2e04g43n71yt,s,3631 STSSStumpuureiadgctlieeiloarnAylnts,,Ln,42ie52m1c1taulrMerse,di7cine & Surgery, 40 56